Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4583

Name

MUC2

Synonym

MLP|MUC-2|SMUC;mucin 2, oligomeric mucus/gel-forming;MUC2;mucin 2, oligomeric mucus/gel-forming

Definition

intestinal mucin-2|mucin 2, intestinal/tracheal|mucin-2|mucin-like protein

Position

11p15.5

Gene Type

protein-coding

Pathways and Diseases

Pathway

Vibrio cholerae infection;KEGG PATHWAY;hsa05110

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

trefoil factors initiate mucosal healing;PID BioCarta;100018

Disease

Alimentary system disease;FunDO

Disease

atopy;GAD

Disease

IMMUNE;GAD

Disease

Barrett's esophagus;FunDO

Disease

Asthma;GAD

Disease

Connective tissue disease;FunDO

Disease

Cancer;FunDO

Disease

Kidney disease;FunDO

External Links

Links to Entrez Gene

4583

Links to all GeneRIF Items

4583

Links to iHOP

4583

Sequence Information

Nucleotide Sequence

>4583 : length: 15540
atggggctgccactagcccgcctggcggctgtgtgcctggccctgtctttggcagggggc
tcggagctccagacagagggcagaacccgaaaccacggccacaacgtctgcagcacctgg
ggcaacttccactacaagaccttcgacggggacgtcttccgcttccccggcctctgcgac
tacaacttcgcctccgactgccgaggctcctacaaggaatttgctgtgcacctgaagcgg
ggtccgggccaggctgaggcccccgccggggtggagtccatcctgctgaccatcaaggat
gacaccatctacctcacccgccacctggctgtgcttaacggggccgtggtcagcaccccg
cactacagccccgggctgctcattgagaagagcgatgcctacaccaaagtctactcccgc
gccggcctcaccctcatgtggaaccgggaggatgcactcatgctggagctggacactaag
ttccggaaccacacctgtggcctctgcggggactacaacggcctgcagagctattcagaa
ttcctctctgacggcgtgctcttcagtcccctggagtttgggaacatgcagaagatcaac
cagcccgatgtggtgtgtgaggatcccgaggaggaggtggcccccgcatcctgctccgag
caccgcgccgagtgtgagaggctgctgaccgccgaggccttcgcggactgtcaggacctg
gtgccgctggagccgtatctgcgcgcctgccagcaggaccgctgccggtgcccgggcggt
gacacctgcgtctgcagcaccgtggccgagttctcccgccagtgctcccacgccggcggc
cggcccgggaactggaggaccgccacgctctgccccaagacctgccccgggaacctggtg
tacctggagagcggctcgccctgcatggacacctgctcacacctggaggtgagcagcctg
tgcgaggagcaccgcatggacggctgtttctgcccagaaggcaccgtatatgacgacatc
ggggacagtggctgcgttcctgtgagccagtgccactgcaggctgcacggacacctgtac
acaccgggccaggagatcaccaatgactgcgagcagtgtgtctgtaacgctggccgctgg
gtgtgcaaagacctgccctgccccggcacctgtgccctggaaggcggctcccacatcacc
accttcgatgggaagacgtacaccttccacggggactgctactatgtcctggccaagggt
gaccacaacgattcctacgctctcctgggcgagctggccccctgtggctccacagacaag
cagacctgcctgaagacggtggtgctgctggctgacaagaagaagaatgtggtggtcttc
aagtccgatggcagtgtactgctcaacgagctgcaggtgaacctgccccacgtgaccgcg
agcttctctgtcttccgcccgtcttcctaccacatcatggtgagcatggccattggcgtc
cggctgcaggtgcagctggccccagtcatgcaactctttgtgacactggaccaggcctcc
caggggcaggtgcagggcctctgcgggaacttcaacggcctggaaggtgacgacttcaag
acggccagcgggctggtggaggccacgggggccggctttgccaacacctggaaggcacag
tcaagctgccatgacaagctggactggttggacgatccctgctccctgaacatcgagagc
gccaactacgccgagcactggtgctccctcctgaagaagacagagaccccctttggcagg
tgccactcggctgtggaccctgctgagtattacaagaggtgcaaatatgacacgtgtaac
tgtcagaacaatgaggactgcctgtgcgccgccctgtcctcctacgcgcgcgcctgcacc
gccaagggcgtcatgctgtggggctggcgggagcatgtctgcaacaaggatgtgggctcc
tgccccaactcgcaggtcttcctgtacaacctgaccacctgccagcagacctgccgctcc
ctctccgaggccgacagccactgtctcgagggctttgcgcctgtggacggctgcggctgc
cctgaccacaccttcctggacgagaagggccgctgcgtacccctggccaagtgctcctgt
taccaccgcggtctctacctggaggcgggggatgtggtcgtcaggcaggaagaacgatgt
gtgtgccgggatgggcggctgcactgtaggcagatccggctgatcggccagagctgcacg
gccccaaagatccacatggactgcagcaacctgactgcactggccacctcgaagccccga
gccctcagctgccagacgctggccgccggctattaccacacagagtgtgtcagtggctgt
gtgtgccccgacgggctgatggatgacggccggggtggctgcgtggtggagaaggaatgc
ccttgcgtccataacaacgacctgtattcttccggcgccaagatcaaggtggactgcaat
acctgcacctgcaagagaggacgctgggtgtgcacccaggctgtgtgccatggcacctgc
tccatttacgggagtggccactacatcacctttgatgggaagtactacgactttgacgga
cactgctcctacgtggctgttcaggactactgcggccagaactcctcactgggctcattc
agcatcatcaccgagaacgtcccctgtggcactacgggcgtcacctgctccaaggccatc
aagatcttcatggggaggacggagctgaagttggaagacaagcaccgtgtggtgatccag
cgtgatgagggtcaccacgtggcctacaccacgcgggaggtgggccagtacctggtggtg
gagtccagcacgggcatcatcgtcatctgggacaagaggaccaccgtgttcatcaagctg
gctccctcctacaagggcaccgtgtgtggcctgtgtgggaactttgaccaccgctccaac
aacgacttcaccacgcgggaccacatggtggtgagcagcgagctggacttcgggaacagc
tggaaggaggcccccacctgcccagatgtgagcaccaaccccgagccctgcagcctgaac
ccgcaccgccgctcctgggccgagaagcagtgcagcatcctcaaaagcagcgtgttcagc
atctgccacagcaaggtggaccccaagcccttctacgaggcctgtgtgcacgactcgtgc
tcctgtgacacgggtggggactgtgagtgcttctgctctgccgtggcctcctacgcccag
gagtgtaccaaagagggggcctgcgtgttctggaggacgccggacctgtgccccatattc
tgcgactactacaaccctccgcatgagtgtgagtggcactatgagccatgtgggaaccgg
agcttcgagacctgcaggaccatcaacggcatccactccaacatctccgtgtcctacctg
gagggctgctacccccggtgccccaaggacaggcccatctatgaggaggatctgaagaag
tgtgtcactgcagacaagtgtggctgctatgtcgaggacacccactacccacctggagca
tcggttcccaccgaggagacctgcaagtcctgcgtgtgtaccaactcctcccaagtcgtc
tgcaggccggaggaaggaaagattcttaaccagacccaggatggcgccttctgctactgg
gagatctgtggccccaacgggacggtggagaagcacttcaacatctgttccattacgaca
cgcccgtccaccctgaccaccttcaccaccatcaccctccccaccacccccaccaccttc
accactaccaccaccaccaccaccccgacctccagcacagttttatcaacaactccgaag
ctgtgctgcctctggtctgactggatcaatgaggaccaccccagcagtggcagcgacgac
ggtgaccgagaaacatttgatggggtctgcggggcccctgaggacatcgagtgcaggtcg
gtcaaggatccccacctcagcttggagcagctaggccagaaggtgcagtgtgatgtctct
gttgggttcatttgcaagaatgaagaccagtttggaaatggaccatttggactgtgttac
gactacaagatacgtgtcaattgttgctggcccatggataagtgtatcaccactcccagc
cctccaactaccactcccagccctccaccaaccagcacgaccacccttccaccaaccacc
acccccagccctccaaccaccaccacaaccacccctccaccaaccaccacccccagccct
ccaataaccaccacgaccacccctccaccaaccaccactcccagccctccaataagcacc
acaaccacccctccaccaaccaccactcccagccctccaaccaccactcccagccctcca
accaccactcccagccctccaacaaccaccacaaccacccctccaccaaccaccactccc
agccctccaacgactacgcccatcactccaccagccagcactaccacccttccaccaacc
accactcccagccctccaacaaccaccacaaccacccctccaccaaccaccactcccagt
cctccaacgactacgcccatcactccaccaaccagcactactacccttccaccaaccacc
actcccagccctccaccaaccaccacaaccacccctccaccaaccaccactcccagccct
ccaacaaccaccactcccagtcctccaacaatcaccacaaccacccctccaccaaccacc
actcccagccctccaacaacgaccacaaccacccctccaccaaccaccactcccagccct
ccaacgactacacccatcactccaccaaccagcactaccacccttccaccaaccaccact
cccagccctccaccaaccaccacaaccacccctccaccaaccaccactcccagccctcca
acaaccaccactcccagccctccaataaccaccacaaccacccctccaccaaccaccact
cccagctctccaataaccaccactcccagccctccaacaaccaccatgaccaccccttca
ccaaccaccacccccagctctccaataaccaccacaaccaccccttcctcaactaccact
cccagccctccaccaaccaccatgaccaccccttcaccaaccaccactcccagccctcca
acaaccaccatgaccacccttccaccaaccaccacttccagccctctaacaactactcct
ctacctccatcaataactcctcctacattttcaccattctcaacgacaacccctactacc
ccatgcgtgcctctctgcaattggactggctggctggattctggaaaacccaactttcac
aaaccaggtggagacacagaattgattggagacgtctgtggaccaggctgggcagctaac
atctcttgcagagccaccatgtatcctgatgttcccattggacagcttggacaaacagtg
gtgtgtgatgtctctgtggggctgatatgcaaaaatgaagaccaaaagccaggtggggtc
atccctatggccttctgcctcaactacgagatcaacgttcagtgctgtgagtgtgtcacc
caacccaccaccatgacaaccaccaccacagagaacccaactccgccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacaccc
atcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaacc
acgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacag
accccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccacc
ggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacccca
acacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacc
ccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccact
acggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcacc
accaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgaca
cccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacccca
accacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcaca
cagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacaccc
accggcacacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaacc
ccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtg
accccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccaccacc
actacggtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatc
accaccaccactacggtgaccccaaccccaacacccaccggcacacagaccccaaccacg
acacccatcaccaccaccactacggtgaccccaaccccaacacccaccggcacacagacc
ccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaacacccaccggc
acacagaccccaaccacgacacccatcaccaccaccactacggtgaccccaaccccaaca
cccaccggcacacagaccccaaccacgacacccatcaccaccaccactacggtgacccca
accccaacacccaccggcacacagaccccaaccacgacacccatcaccaccaccactacg
gtgaccccaaccccaacacccaccggcacacagaccccaaccacgacacccatcaccacc
accactacggtgaccccaaccccaacacccaccggcacacagaccgggccccccacccac
acaagcacagcaccgattgctgagttgaccacatccaatcctccgcctgagtcctcaacc
cctcagacctctcggtccacctcttcccctctcacggagtcaaccacccttctgagtacc
ctaccacctgccattgagatgaccagcacggccccaccctccacacccacggcacccacg
accacgagcggaggccacacactgtctccaccgcccagcaccaccacgtcccctccaggc
acccccactcgcggtaccacgaccgggtcatcttcagcccccacccccagcactgtgcag
acgaccaccaccagtgcctggaccccaacgccgaccccactctccacacccagcatcatc
aggaccacaggcctgaggccctacccttcctctgtgcttatctgctgtgtcctgaacgac
acctactacgcaccaggtgaggaggtgtacaacggcacatacggagacacctgttatttc
gtcaactgctcactgagctgtacgttggagttctataactggtcctgcccatccacgccc
tccccaacacccacgccctccaagtcgacgcccacgccttccaagccatcgtccacgccc
tccaagccgacgcccggcaccaagccccccgagtgcccagactttgatcctcccagacag
gagaacgagacttggtggctgtgcgactgcttcatggccacgtgcaagtacaacaacacg
gtggagatcgtgaaggtggagtgtgagccgccgcccatgcccacctgctccaacggcctc
caacccgtgcgcgtcgaggaccccgacggctgctgctggcactgggagtgcgactgctac
tgcacgggctggggcgacccgcactatgtcaccttcgacggactctactacagctaccag
ggcaactgcacctacgtgctggtggaggagatcagcccctccgtggacaacttcggagtt
tacatcgacaactaccactgcgatcccaacgacaaggtgtcctgtccccgcaccctcatc
gtgcgccacgagacccaggaggtgctgatcaagaccgtgcatatgatgcccatgcaggtg
caggtgcaggtgaacaggcaggcggtggcactgccctacaagaagtacgggctggaggtg
taccagtctggcatcaactacgtggtggacatccccgagctgggtgtcctcgtctcctac
aatggcctgtccttctccgtcaggctgccctaccaccggtttggcaacaacaccaagggc
cagtgtggcacctgcaccaacaccacctccgacgactgcattctgcccagcggggagatc
gtctccaactgtgaggctgcggctgaccagtggctggtgaacgacccctccaagccacac
tgcccccacagcagctccacgaccaagcgcccggccgtcactgtgcccgggggcggtaaa
acgaccccacacaaggactgcaccccatctcccctctgccagctcatcaaggacagcctg
tttgcccagtgccacgcactggtgcccccgcagcactactacgatgcctgcgtgttcgac
agctgcttcatgccgggctcgagcctggagtgcgccagtctgcaggcctacgcagccctc
tgtgcccagcagaacatctgcctcgactggcggaaccacacgcatggggcctgcttggtg
gagtgcccatctcacagggagtaccaggcctgtggccctgcagaagagcccacgtgcaaa
tccagctcctcccagcagaacaacacagtcctggtggaaggctgcttctgtcctgagggc
accatgaactacgctcctggctttgatgtctgcgtgaagacctgcggctgtgtgggacct
gacaatgtgcccagagagtttggggagcacttcgagttcgactgcaagaactgtgtctgc
ctggagggtggaagtggcatcatctgccaacccaagaggtgcagccagaagcccgttacc
cactgcgtggaagacggcacctacctcgccacggaggtcaaccctgccgacacctgctgc
aacattaccgtctgcaagtgcaacaccagcctgtgcaaagagaagccctccgtgtgcccg
ctgggattcgaagtgaagagcaagatggtgcctggaaggtgctgtcctttctactggtgt
gagtccaagggggtgtgtgttcacgggaatgctgagtaccagcccggttctccagtttat
tcctccaagtgccaggactgcgtgtgcacggacaaggtggacaacaacaccctgctcaac
gtcatcgcctgcacccacgtgccctgcaacacctcctgcagccctggcttcgaactcatg
gaggcccccggggagtgctgtaagaagtgtgaacagacgcactgtatcatcaaacggccc
gacaaccagcacgtcatcctgaagcccggggacttcaagagcgacccgaagaacaactgc
acattcttcagctgcgtgaagatccacaaccagctcatctcgtccgtctccaacatcacc
tgccccaactttgatgccagcatttgcatcccgggctccatcacattcatgcccaatgga
tgctgcaagacctgcacccctcgcaatgagaccagggtgccctgctccaccgtccccgtc
accacggaggtttcgtacgccggctgcaccaagaccgtcctcatgaatcattgctccggg
tcctgcgggacatttgtcatgtactcggccaaggcccaggccctggaccacagctgctcc
tgctgcaaagaggagaaaaccagccagcgtgaggtggtcctgagctgccccaatggcggc
tcgctgacacacacctacacccacatcgagagctgccagtgccaggacaccgtctgcggg
ctccccaccggcacctcccgccgggcccggcgctcccctaggcatctggggagcgggtga

Protein Sequence

>4583 : length: 5179
MGLPLARLAAVCLALSLAGGSELQTEGRTRNHGHNVCSTWGNFHYKTFDGDVFRFPGLCD
YNFASDCRGSYKEFAVHLKRGPGQAEAPAGVESILLTIKDDTIYLTRHLAVLNGAVVSTP
HYSPGLLIEKSDAYTKVYSRAGLTLMWNREDALMLELDTKFRNHTCGLCGDYNGLQSYSE
FLSDGVLFSPLEFGNMQKINQPDVVCEDPEEEVAPASCSEHRAECERLLTAEAFADCQDL
VPLEPYLRACQQDRCRCPGGDTCVCSTVAEFSRQCSHAGGRPGNWRTATLCPKTCPGNLV
YLESGSPCMDTCSHLEVSSLCEEHRMDGCFCPEGTVYDDIGDSGCVPVSQCHCRLHGHLY
TPGQEITNDCEQCVCNAGRWVCKDLPCPGTCALEGGSHITTFDGKTYTFHGDCYYVLAKG
DHNDSYALLGELAPCGSTDKQTCLKTVVLLADKKKNVVVFKSDGSVLLNELQVNLPHVTA
SFSVFRPSSYHIMVSMAIGVRLQVQLAPVMQLFVTLDQASQGQVQGLCGNFNGLEGDDFK
TASGLVEATGAGFANTWKAQSSCHDKLDWLDDPCSLNIESANYAEHWCSLLKKTETPFGR
CHSAVDPAEYYKRCKYDTCNCQNNEDCLCAALSSYARACTAKGVMLWGWREHVCNKDVGS
CPNSQVFLYNLTTCQQTCRSLSEADSHCLEGFAPVDGCGCPDHTFLDEKGRCVPLAKCSC
YHRGLYLEAGDVVVRQEERCVCRDGRLHCRQIRLIGQSCTAPKIHMDCSNLTALATSKPR
ALSCQTLAAGYYHTECVSGCVCPDGLMDDGRGGCVVEKECPCVHNNDLYSSGAKIKVDCN
TCTCKRGRWVCTQAVCHGTCSIYGSGHYITFDGKYYDFDGHCSYVAVQDYCGQNSSLGSF
SIITENVPCGTTGVTCSKAIKIFMGRTELKLEDKHRVVIQRDEGHHVAYTTREVGQYLVV
ESSTGIIVIWDKRTTVFIKLAPSYKGTVCGLCGNFDHRSNNDFTTRDHMVVSSELDFGNS
WKEAPTCPDVSTNPEPCSLNPHRRSWAEKQCSILKSSVFSICHSKVDPKPFYEACVHDSC
SCDTGGDCECFCSAVASYAQECTKEGACVFWRTPDLCPIFCDYYNPPHECEWHYEPCGNR
SFETCRTINGIHSNISVSYLEGCYPRCPKDRPIYEEDLKKCVTADKCGCYVEDTHYPPGA
SVPTEETCKSCVCTNSSQVVCRPEEGKILNQTQDGAFCYWEICGPNGTVEKHFNICSITT
RPSTLTTFTTITLPTTPTTFTTTTTTTTPTSSTVLSTTPKLCCLWSDWINEDHPSSGSDD
GDRETFDGVCGAPEDIECRSVKDPHLSLEQLGQKVQCDVSVGFICKNEDQFGNGPFGLCY
DYKIRVNCCWPMDKCITTPSPPTTTPSPPPTSTTTLPPTTTPSPPTTTTTTPPPTTTPSP
PITTTTTPPPTTTPSPPISTTTTPPPTTTPSPPTTTPSPPTTTPSPPTTTTTTPPPTTTP
SPPTTTPITPPASTTTLPPTTTPSPPTTTTTTPPPTTTPSPPTTTPITPPTSTTTLPPTT
TPSPPPTTTTTPPPTTTPSPPTTTTPSPPTITTTTPPPTTTPSPPTTTTTTPPPTTTPSP
PTTTPITPPTSTTTLPPTTTPSPPPTTTTTPPPTTTPSPPTTTTPSPPITTTTTPPPTTT
PSSPITTTPSPPTTTMTTPSPTTTPSSPITTTTTPSSTTTPSPPPTTMTTPSPTTTPSPP
TTTMTTLPPTTTSSPLTTTPLPPSITPPTFSPFSTTTPTTPCVPLCNWTGWLDSGKPNFH
KPGGDTELIGDVCGPGWAANISCRATMYPDVPIGQLGQTVVCDVSVGLICKNEDQKPGGV
IPMAFCLNYEINVQCCECVTQPTTMTTTTTENPTPPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTP
ITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPT
GTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTT
TVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTP
TTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPT
PTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPI
TTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTG
TQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTT
VTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPT
TTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTP
TPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPIT
TTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGT
QTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTV
TPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTT
TPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPT
PTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITT
TTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQ
TPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVT
PTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTT
PITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTP
TGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTT
TTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQT
PTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTP
TPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTPTTTPITTTTTVTPTPTPTGTQTGPPTH
TSTAPIAELTTSNPPPESSTPQTSRSTSSPLTESTTLLSTLPPAIEMTSTAPPSTPTAPT
TTSGGHTLSPPPSTTTSPPGTPTRGTTTGSSSAPTPSTVQTTTTSAWTPTPTPLSTPSII
RTTGLRPYPSSVLICCVLNDTYYAPGEEVYNGTYGDTCYFVNCSLSCTLEFYNWSCPSTP
SPTPTPSKSTPTPSKPSSTPSKPTPGTKPPECPDFDPPRQENETWWLCDCFMATCKYNNT
VEIVKVECEPPPMPTCSNGLQPVRVEDPDGCCWHWECDCYCTGWGDPHYVTFDGLYYSYQ
GNCTYVLVEEISPSVDNFGVYIDNYHCDPNDKVSCPRTLIVRHETQEVLIKTVHMMPMQV
QVQVNRQAVALPYKKYGLEVYQSGINYVVDIPELGVLVSYNGLSFSVRLPYHRFGNNTKG
QCGTCTNTTSDDCILPSGEIVSNCEAAADQWLVNDPSKPHCPHSSSTTKRPAVTVPGGGK
TTPHKDCTPSPLCQLIKDSLFAQCHALVPPQHYYDACVFDSCFMPGSSLECASLQAYAAL
CAQQNICLDWRNHTHGACLVECPSHREYQACGPAEEPTCKSSSSQQNNTVLVEGCFCPEG
TMNYAPGFDVCVKTCGCVGPDNVPREFGEHFEFDCKNCVCLEGGSGIICQPKRCSQKPVT
HCVEDGTYLATEVNPADTCCNITVCKCNTSLCKEKPSVCPLGFEVKSKMVPGRCCPFYWC
ESKGVCVHGNAEYQPGSPVYSSKCQDCVCTDKVDNNTLLNVIACTHVPCNTSCSPGFELM
EAPGECCKKCEQTHCIIKRPDNQHVILKPGDFKSDPKNNCTFFSCVKIHNQLISSVSNIT
CPNFDASICIPGSITFMPNGCCKTCTPRNETRVPCSTVPVTTEVSYAGCTKTVLMNHCSG
SCGTFVMYSAKAQALDHSCSCCKEEKTSQREVVLSCPNGGSLTHTYTHIESCQCQDTVCG
LPTGTSRRARRSPRHLGSG



')