Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4582

Name

MUC1

Synonym

CD227|EMA|H23AG|KL-6|MAM6|MUC-1|MUC-1/SEC|MUC-1/X|MUC1/ZD|PEM|PEMT|PUM;mucin 1, cell surface associated;MUC1;mucin 1, cell surface associated

Definition

DF3 antigen|H23 antigen|breast carcinoma-associated antigen DF3|carcinoma-associated mucin|episialin|mucin 1, transmembrane|mucin-1|peanut-reactive urinary mucin|polymorphic epithelial mucin|tumor associated epithelial mucin|tumor-associated epithelial me

Position

1q21

Gene Type

protein-coding

External Links

Links to Entrez Gene

4582

Links to all GeneRIF Items

4582

Links to iHOP

4582

Sequence Information

Nucleotide Sequence

>4582 : length: 795
atgacaccgggcacccagtctcctttcttcctgctgctgctcctcacagtgcttacagct
accacagcccctaaacccgcaacagttgttacgggttctggtcatgcaagctctacccca
ggtggagaaaaggagacttcggctacccagagaagttcagtgcccagctctactgagaag
aatgcttttaattcctctctggaagatcccagcaccgactactaccaagagctgcagaga
gacatttctgaaatgtttttgcagatttataaacaagggggttttctgggcctctccaat
attaagttcaggccaggatctgtggtggtacaattgactctggccttccgagaaggtacc
atcaatgtccacgacgtggagacacagttcaatcagtataaaacggaagcagcctctcga
tataacctgacgatctcagacgtcagcgtgagtgatgtgccatttcctttctctgcccag
tctggggctggggtgccaggctggggcatcgcgctgctggtgctggtctgtgttctggtt
gcgctggccattgtctatctcattgccttggctgtctgtcagtgccgccgaaagaactac
gggcagctggacatctttccagcccgggatacctaccatcctatgagcgagtaccccacc
taccacacccatgggcgctatgtgccccctagcagtaccgatcgtagcccctatgagaag
gtttctgcaggtaatggtggcagcagcctctcttacacaaacccagcagtggcagccact
tctgccaacttgtag

Protein Sequence

>4582 : length: 264
MTPGTQSPFFLLLLLTVLTATTAPKPATVVTGSGHASSTPGGEKETSATQRSSVPSSTEK
NAFNSSLEDPSTDYYQELQRDISEMFLQIYKQGGFLGLSNIKFRPGSVVVQLTLAFREGT
INVHDVETQFNQYKTEAASRYNLTISDVSVSDVPFPFSAQSGAGVPGWGIALLVLVCVLV
ALAIVYLIALAVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEK
VSAGNGGSSLSYTNPAVAATSANL



')