Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4488

Name

MSX2

Synonym

CRS2|FPP|HOX8|MSH|PFM|PFM1;msh homeobox 2;MSX2;msh homeobox 2

Definition

homeobox protein Hox-8|homeobox protein MSX-2|msh homeo box 2|msh homeobox homolog 2

Position

5q35.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

4488

Links to all GeneRIF Items

4488

Links to iHOP

4488

Sequence Information

Nucleotide Sequence

>4488 : length: 804
atggcttctccgtccaaaggcaatgacttgttttcgcccgacgaggagggcccagcagtg
gtggccggaccaggcccggggcctgggggcgccgagggggccgcggaggagcgccgcgtc
aaggtctccagcctgcccttcagcgtggaggcgctcatgtccgacaagaagccgcccaag
gaggcgtccccgctgccggccgaaagcgcctcggccggggccaccctgcggccactgctg
ctgtcggggcacggcgctcgggaagcgcacagccccgggccgctggtgaagcccttcgag
accgcctcggtcaagtcggaaaattcagaagatggagcggcgtggatgcaggaacccggc
cgatattcgccgccgccaagacatatgagccctaccacctgcaccctgaggaaacacaag
accaatcggaagccgcgcacgccctttaccacatcccagctcctcgccctggagcgcaag
ttccgtcagaaacagtacctctccattgcagagcgtgcagagttctccagctctctgaac
ctcacagagacccaggtcaaaatctggttccagaaccgaagggccaaggcgaaaagactg
caggaggcagaactggaaaagctgaaaatggctgcaaaacctatgctgccctccagcttc
agtctccctttccccatcagctcgcccctgcaggcagcgtccatatatggagcatcctac
ccgttccatagacctgtgcttcccatcccgcctgtgggactctatgccacgccagtggga
tatggcatgtaccacctgtcctaa

Protein Sequence

>4488 : length: 267
MASPSKGNDLFSPDEEGPAVVAGPGPGPGGAEGAAEERRVKVSSLPFSVEALMSDKKPPK
EASPLPAESASAGATLRPLLLSGHGAREAHSPGPLVKPFETASVKSENSEDGAAWMQEPG
RYSPPPRHMSPTTCTLRKHKTNRKPRTPFTTSQLLALERKFRQKQYLSIAERAEFSSSLN
LTETQVKIWFQNRRAKAKRLQEAELEKLKMAAKPMLPSSFSLPFPISSPLQAASIYGASY
PFHRPVLPIPPVGLYATPVGYGMYHLS



')