Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4486

Name

MST1R

Synonym

CD136|CDw136|PTK8|RON;macrophage stimulating 1 receptor (c-met-related tyrosine kinase);MST1R;macrophage stimulating 1 receptor (c-met-related tyrosine kinase)

Definition

MSP receptor|PTK8 protein tyrosine kinase 8|RON variant E2E3|c-met-related tyrosine kinase|macrophage-stimulating protein receptor|p185-Ron|soluble RON variant 1|soluble RON variant 2|soluble RON variant 3|soluble RON variant 4

Position

3p21.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Ulcerative colitis;FunDO

Disease

Endometriosis;FunDO

Disease

Cancer;FunDO

Disease

Enteritis;FunDO

Disease

Multiple sclerosis;FunDO

External Links

Links to Entrez Gene

4486

Links to all GeneRIF Items

4486

Links to iHOP

4486

Sequence Information

Nucleotide Sequence

>4486 : length: 4203
atggagctcctcccgccgctgcctcagtccttcctgttgctgctgctgttgcctgccaag
cccgcggcgggcgaggactggcagtgcccgcgcaccccctacgcggcctctcgcgacttt
gacgtgaagtacgtggtgcccagcttctccgccggaggcctggtacaggccatggtgacc
tacgagggcgacagaaatgagagtgctgtgtttgtagccatacgcaatcgcctgcatgtg
cttgggcctgacctgaagtctgtccagagcctggccacgggccctgctggagaccctggc
tgccagacgtgtgcagcctgtggcccaggaccccacggccctcccggtgacacagacaca
aaggtgctggtgctggatcccgcgctgcctgcgctggtcagttgtggctccagcctgcag
ggccgctgcttcctgcatgacctagagccccaagggacagccgtgcatctggcagcgcca
gcctgcctcttctcagcccaccataaccggcccgatgactgccccgactgtgtggccagc
ccattgggcacccgtgtaactgtggttgagcaaggccaggcctcctatttctacgtggca
tcctcactggacgcagccgtggctgccagcttcagcccacgctcagtgtctatcaggcgt
ctcaaggctgacgcctcgggattcgcaccgggctttgtggcgttgtcagtgctgcccaag
catcttgtctcctacagtattgaatacgtgcacagcttccacacgggagccttcgtatac
ttcctgactgtacagccggccagcgtgacagatgatcctagtgccctgcacacacgcctg
gcacggcttagcgccactgagccagagttgggtgactatcgggagctggtcctcgactgc
agatttgctccaaaacgcaggcgccggggggccccagaaggcggacagccctaccctgtg
ctgcgggtggcccactccgctccagtgggtgcccaacttgccactgagctgagcatcgcc
gagggccaggaagtactatttggggtctttgtgactggcaaggatggtggtcctggcgtg
ggccccaactctgtcgtctgtgccttccccattgacctgctggacacactaattgatgag
ggtgtggagcgctgttgtgaatccccagtccatccaggcctccggcgaggcctcgacttc
ttccagtcgcccagtttttgccccaacccgcctggcctggaagccctcagccccaacacc
agctgccgccacttccctctgctggtcagtagcagcttctcacgtgtggacctattcaat
gggctgttgggaccagtacaggtcactgcattgtatgtgacacgccttgacaacgtcaca
gtggcacacatgggcacaatggatgggcgtatcctgcaggtggagctggtcaggtcacta
aactacttgctgtatgtgtccaacttctcactgggtgacagtgggcagcccgtgcagcgg
gatgtcagtcgtcttggggaccacctactctttgcctctggggaccaggttttccaggta
cctatccaaggccctggctgccgccacttcctgacctgtgggcgttgcctaagggcatgg
catttcatgggctgtggctggtgtgggaacatgtgcggccagcagaaggagtgtcctggc
tcctggcaacaggaccactgcccacctaagcttactgagttccacccccacagtggacct
ctaaggggcagtacaaggctgaccctgtgtggctccaacttctaccttcacccttctggt
ctggtgcctgagggaacccatcaggtcactgtgggccaaagtccctgccggccactgccc
aaggacagctcaaaactcagaccagtgccccggaaagactttgtagaggagtttgagtgt
gaactggagcccttgggcacccaggcagtggggcctaccaacgtcagcctcaccgtgact
aacatgccaccgggcaagcacttccgggtagacggcacctccgtgctgagaggcttctct
ttcatggagccagtgctgatagcagtgcaacccctctttggcccacgggcaggaggcacc
tgtctcactcttgaaggccagagtctgtctgtaggcaccagccgggctgtgctggtcaat
gggactgagtgtctgctagcacgggtcagtgaggggcagcttttatgtgccacaccccct
ggggccacggtggccagtgtcccccttagcctgcaggtggggggtgcccaggtacctggt
tcctggaccttccagtacagagaagaccctgtcgtgctaagcatcagccccaactgtggc
tacatcaactcccacatcaccatctgtggccagcatctaacttcagcatggcacttagtg
ctgtcattccatgacgggcttagggcagtggaaagcaggtgtgagaggcagcttccagag
cagcagctgtgccgccttcctgaatatgtggtccgagacccccagggatgggtggcaggg
aatctgagtgcccgaggggatggagctgctggctttacactgcctggctttcgcttccta
cccccaccccatccacccagtgccaacctagttccactgaagcctgaggagcatgccatt
aagtttgagtatattgggctgggcgctgtggctgactgtgtgggtatcaacgtgaccgtg
ggtggtgagagctgccagcacgagttccggggggacatggttgtctgccccctgccccca
tccctgcagcttggccaggatggtgccccattgcaggtctgcgtagatggtgaatgtcat
atcctgggtagagtggtgcggccagggccagatggggtcccacagagcacgctccttggt
atcctgctgcctttgctgctgcttgtggctgcactggcgactgcactggtcttcagctac
tggtggcggaggaagcagctagttcttcctcccaacctgaatgacctggcatccctggac
cagactgctggagccacacccctgcctattctgtactcgggctctgactacagaagtggc
cttgcactccctgccattgatggtctggattccaccacttgtgtccatggagcatccttc
tccgatagtgaagatgaatcctgtgtgccactgctgcggaaagagtccatccagctaagg
gacctggactctgcgctcttggctgaggtcaaggatgtgctgattccccatgagcgggtg
gtcacccacagtgaccgagtcattggcaaaggccactttggagttgtctaccacggagaa
tacatagaccaggcccagaatcgaatccaatgtgccatcaagtcactaagtcgcatcaca
gagatgcagcaggtggaggccttcctgcgagaggggctgctcatgcgtggcctgaaccac
ccgaatgtgctggctctcattggtatcatgttgccacctgagggcctgccccatgtgctg
ctgccctatatgtgccacggtgacctgctccagttcatccgctcacctcagcggaacccc
accgtgaaggacctcatcagctttggcctgcaggtagcccgcggcatggagtacctggca
gagcagaagtttgtgcacagggacctggctgcgcggaactgcatgctggacgagtcattc
acagtcaaggtggctgactttggtttggcccgcgacatcctggacagggagtactatagt
gttcaacagcatcgccacgctcgcctacctgtgaagtggatggcgctggagagcctgcag
acctatagatttaccaccaagtctgatgtgtggtcatttggtgtgctgctgtgggaactg
ctgacacggggtgccccaccataccgccacattgacccttttgaccttacccacttcctg
gcccagggtcggcgcctgccccagcctgagtattgccctgattctctgtaccaagtgatg
cagcaatgctgggaggcagacccagcagtgcgacccaccttcagagtactagtgggggag
gtggagcagatagtgtctgcactgcttggggaccattatgtgcagctgccagcaacctac
atgaacttgggccccagcacctcgcatgagatgaatgtgcgtccagaacagccgcagttc
tcacccatgccagggaatgtacgccggccccggccactctcagagcctcctcggcccact
tga

Protein Sequence

>4486 : length: 1400
MELLPPLPQSFLLLLLLPAKPAAGEDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVT
YEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDT
KVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVAS
PLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPK
HLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDC
RFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGV
GPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNT
SCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSL
NYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAW
HFMGCGWCGNMCGQQKECPGSWQQDHCPPKLTEFHPHSGPLRGSTRLTLCGSNFYLHPSG
LVPEGTHQVTVGQSPCRPLPKDSSKLRPVPRKDFVEEFECELEPLGTQAVGPTNVSLTVT
NMPPGKHFRVDGTSVLRGFSFMEPVLIAVQPLFGPRAGGTCLTLEGQSLSVGTSRAVLVN
GTECLLARVSEGQLLCATPPGATVASVPLSLQVGGAQVPGSWTFQYREDPVVLSISPNCG
YINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAG
NLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKPEEHAIKFEYIGLGAVADCVGINVTV
GGESCQHEFRGDMVVCPLPPSLQLGQDGAPLQVCVDGECHILGRVVRPGPDGVPQSTLLG
ILLPLLLLVAALATALVFSYWWRRKQLVLPPNLNDLASLDQTAGATPLPILYSGSDYRSG
LALPAIDGLDSTTCVHGASFSDSEDESCVPLLRKESIQLRDLDSALLAEVKDVLIPHERV
VTHSDRVIGKGHFGVVYHGEYIDQAQNRIQCAIKSLSRITEMQQVEAFLREGLLMRGLNH
PNVLALIGIMLPPEGLPHVLLPYMCHGDLLQFIRSPQRNPTVKDLISFGLQVARGMEYLA
EQKFVHRDLAARNCMLDESFTVKVADFGLARDILDREYYSVQQHRHARLPVKWMALESLQ
TYRFTTKSDVWSFGVLLWELLTRGAPPYRHIDPFDLTHFLAQGRRLPQPEYCPDSLYQVM
QQCWEADPAVRPTFRVLVGEVEQIVSALLGDHYVQLPATYMNLGPSTSHEMNVRPEQPQF
SPMPGNVRRPRPLSEPPRPT



')