Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4478

Name

MSN

Synonym

-;moesin;MSN;moesin

Definition

membrane-organizing extension spike protein

Position

Xq11.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

RhoA signaling pathway;PID Curated;200007

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Disease

Squamous cell cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Metastasis to lymph nodes;FunDO

Disease

Infection;FunDO

Disease

Congenital abnormality;FunDO

Disease

HIV infection;FunDO

External Links

Links to Entrez Gene

4478

Links to all GeneRIF Items

4478

Links to iHOP

4478

Sequence Information

Nucleotide Sequence

>4478 : length: 1734
atgcccaaaacgatcagtgtgcgtgtgaccaccatggatgcagagctggagtttgccatc
cagcccaacaccaccgggaagcagctatttgaccaggtggtgaaaactattggcttgagg
gaagtttggttctttggtctgcagtaccaggacactaaaggtttctccacctggctgaaa
ctcaataagaaggtgactgcccaggatgtgcggaaggaaagccccctgctctttaagttc
cgtgccaagttctaccctgaggatgtgtccgaggaattgattcaggacatcactcagcgc
ctgttctttctgcaagtgaaagagggcattctcaatgatgatatttactgcccgcctgag
accgctgtgctgctggcctcgtatgctgtccagtctaagtatggcgacttcaataaggaa
gtgcataagtctggctacctggccggagacaagttgctcccgcagagagtcctggaacag
cacaaactcaacaaggaccagtgggaggagcggatccaggtgtggcatgaggaacaccgt
ggcatgctcagggaggatgctgtcctggaatatctgaagattgctcaagatctggagatg
tatggtgtgaactacttcagcatcaagaacaagaaaggctcagagctgtggctgggggtg
gatgccctgggtctcaacatctatgagcagaatgacagactaactcccaagataggcttc
ccctggagtgaaatcaggaacatctctttcaatgataagaaatttgtcatcaagcccatt
gacaaaaaagccccggacttcgtcttctatgctccccggctgcggattaacaagcggatc
ttggccttgtgcatggggaaccatgaactatacatgcgccgtcgcaagcctgataccatt
gaggtgcagcagatgaaggcacaggcccgggaggagaagcaccagaagcagatggagcgt
gctatgctggaaaatgagaagaagaagcgtgaaatggcagagaaggagaaagagaagatt
gaacgggagaaggaggagctgatggagaggctgaagcagatcgaggaacagactaagaag
gctcagcaagaactggaagaacagacccgtagggctctggaacttgagcaggaacggaag
cgtgcccagagcgaggctgaaaagctggccaaggagcgtcaagaagctgaagaggccaag
gaggccttgctgcaggcctcccgggaccagaaaaagactcaggaacagctggccttggaa
atggcagagctgacagctcgaatctcccagctggagatggcccgacagaagaaggagagt
gaggctgtggagtggcagcagaaggcccagatggtacaggaagacttggagaagacccgt
gctgagctgaagactgccatgagtacacctcatgtggcagagcctgctgagaatgagcag
gatgagcaggatgagaatggggcagaggctagtgctgacctacgggctgatgctatggcc
aaggaccgcagtgaggaggaacgtaccactgaggcagagaagaatgagcgtgtgcagaag
cacctgaaggccctcacttcggagctggccaatgccagagatgagtccaagaagactgcc
aatgacatgatccatgctgagaacatgcgactgggccgagacaaatacaagaccctgcgc
cagatccggcagggcaacaccaagcagcgcattgacgaatttgagtctatgtaa

Protein Sequence

>4478 : length: 577
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKGFSTWLK
LNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPE
TAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHR
GMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQMERAMLENEKKKREMAEKEKEKIEREKEELMERLKQIEEQTKK
AQQELEEQTRRALELEQERKRAQSEAEKLAKERQEAEEAKEALLQASRDQKKTQEQLALE
MAELTARISQLEMARQKKESEAVEWQQKAQMVQEDLEKTRAELKTAMSTPHVAEPAENEQ
DEQDENGAEASADLRADAMAKDRSEEERTTEAEKNERVQKHLKALTSELANARDESKKTA
NDMIHAENMRLGRDKYKTLRQIRQGNTKQRIDEFESM



')