Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4322

Name

MMP13

Synonym

CLG3|MANDP1;matrix metallopeptidase 13 (collagenase 3);MMP13;matrix metallopeptidase 13 (collagenase 3)

Definition

MMP-13|collagenase 3|matrix metalloproteinase 13 (collagenase 3)

Position

11q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Plasminogen activating cascade;PANTHER;P00050

Disease

Melanoma;FunDO

Disease

Peripheral nerve sheath cancer;FunDO

Disease

Polyarthritis;FunDO

Disease

Oral cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Mucocutaneous lymph node syndrome;FunDO

Disease

Alveolar bone loss;FunDO

Disease

IMMUNE;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

esophageal cancer gastric cardiac cancer;GAD

Disease

rheumatoid arthritis;GAD

Disease

Colon cancer;FunDO

Disease

Periodontal disease;FunDO

Disease

Spondyloepimetaphyseal dysplasia, Missouri type;OMIM

Disease

CARDIOVASCULAR;GAD

Disease

Stroke;FunDO

Disease

CANCER;GAD

Disease

Metaphyseal anadysplasia 1;OMIM

Disease

Lyme disease;FunDO

Disease

Endometriosis;FunDO

Disease

Heart failure;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Metastasis to lymph nodes;FunDO

Disease

Osteoporosis;FunDO

Disease

gastric cardia adenocarcinoma and esophageal squamous cell carcinoma;GAD

Disease

Atherosclerosis;GAD

Disease

Myelofibrosis;FunDO

External Links

Links to Entrez Gene

4322

Links to all GeneRIF Items

4322

Links to iHOP

4322

Sequence Information

Nucleotide Sequence

>4322 : length: 1416
atgcatccaggggtcctggctgccttcctcttcttgagctggactcattgtcgggccctg
ccccttcccagtggtggtgatgaagatgatttgtctgaggaagacctccagtttgcagag
cgctacctgagatcatactaccatcctacaaatctcgcgggaatcctgaaggagaatgca
gcaagctccatgactgagaggctccgagaaatgcagtctttcttcggcttagaggtgact
ggcaaacttgacgataacaccttagatgtcatgaaaaagccaagatgcggggttcctgat
gtgggtgaatacaatgttttccctcgaactcttaaatggtccaaaatgaatttaacctac
agaattgtgaattacacccctgatatgactcattctgaagtcgaaaaggcattcaaaaaa
gccttcaaagtttggtccgatgtaactcctctgaattttaccagacttcacgatggcatt
gctgacatcatgatctcttttggaattaaggagcatggcgacttctacccatttgatggg
ccctctggcctgctggctcatgcttttcctcctgggccaaattatggaggagatgcccat
tttgatgatgatgaaacctggacaagtagttccaaaggctacaacttgtttcttgttgct
gcgcatgagttcggccactccttaggtcttgaccactccaaggaccctggagcactcatg
tttcctatctacacctacaccggcaaaagccactttatgcttcctgatgacgatgtacaa
gggatccagtctctctatggtccaggagatgaagaccccaaccctaaacatccaaaaacg
ccagacaaatgtgacccttccttatcccttgatgccattaccagtctccgaggagaaaca
atgatctttaaagacagattcttctggcgcctgcatcctcagcaggttgatgcggagctg
tttttaacgaaatcattttggccagaacttcccaaccgtattgatgctgcatatgagcac
ccttctcatgacctcatcttcatcttcagaggtagaaaattttgggctcttaatggttat
gacattctggaaggttatcccaaaaaaatatctgaactgggtcttccaaaagaagttaag
aagataagtgcagctgttcactttgaggatacaggcaagactctcctgttctcaggaaac
caggtctggagatatgatgatactaaccatattatggataaagactatccgagactaata
gaagaagacttcccaggaattggtgataaagtagatgctgtctatgagaaaaatggttat
atctattttttcaacggacccatacagtttgaatacagcatctggagtaaccgtattgtt
cgcgtcatgccagcaaattccattttgtggtgttaa

Protein Sequence

>4322 : length: 471
MHPGVLAAFLFLSWTHCRALPLPSGGDEDDLSEEDLQFAERYLRSYYHPTNLAGILKENA
ASSMTERLREMQSFFGLEVTGKLDDNTLDVMKKPRCGVPDVGEYNVFPRTLKWSKMNLTY
RIVNYTPDMTHSEVEKAFKKAFKVWSDVTPLNFTRLHDGIADIMISFGIKEHGDFYPFDG
PSGLLAHAFPPGPNYGGDAHFDDDETWTSSSKGYNLFLVAAHEFGHSLGLDHSKDPGALM
FPIYTYTGKSHFMLPDDDVQGIQSLYGPGDEDPNPKHPKTPDKCDPSLSLDAITSLRGET
MIFKDRFFWRLHPQQVDAELFLTKSFWPELPNRIDAAYEHPSHDLIFIFRGRKFWALNGY
DILEGYPKKISELGLPKEVKKISAAVHFEDTGKTLLFSGNQVWRYDDTNHIMDKDYPRLI
EEDFPGIGDKVDAVYEKNGYIYFFNGPIQFEYSIWSNRIVRVMPANSILWC



')