Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4318

Name

MMP9

Synonym

CLG4B|GELB|MANDP2|MMP-9;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase);MMP9;matrix metallopeptidase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)

Definition

92 kDa gelatinase|92 kDa type IV collagenase|macrophage gelatinase|matrix metalloproteinase 9 (gelatinase B, 92kDa gelatinase, 92kDa type IV collagenase)|matrix metalloproteinase-9|type V collagenase

Position

20q11.2-q13.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

inhibition of matrix metalloproteinases;PID BioCarta;100045

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

AP-1 transcription factor network;PID Curated;200118

Pathway

amb2 Integrin signaling;PID Curated;200108

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

FGF signaling pathway;PID Curated;200189

Disease

arterial stiffness;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

Respiratory tract disease;FunDO

Disease

Henoch-Schoenlein purpura;FunDO

Disease

Glaucoma;FunDO

Disease

IMMUNE;GAD

Disease

aortic dissection;GAD

Disease

INFECTION;GAD

Disease

Bronchopulmonary dysplasia;FunDO

Disease

Subacute sclerosing panencephalitis;FunDO

Disease

Tropical spastic paraparesis;FunDO

Disease

Penile cancer;KEGG DISEASE;H00025

Disease

Hypertension;FunDO

Disease

ocular Chlamydia trachomatis infection;GAD

Disease

Lupus vulgaris;FunDO

Disease

Transient hypertension of pregnancy;FunDO

Disease

Macular Degeneration;GAD

Disease

myocardial infarct;GAD

Disease

Atherosclerosis;FunDO

Disease

Ischemia;FunDO

Disease

nephropathy;GAD

Disease

Helicobacter infection;FunDO

Disease

oral cancer;GAD

Disease

Emphysema;FunDO

Disease

Amnionitis;FunDO

Disease

atherosclerosis, coronary;GAD

Disease

Metaphyseal anadysplasia 2;OMIM

Disease

prostate cancer;GAD

Disease

Systemic infection;FunDO

Disease

Metabolism disease;FunDO

Disease

emphysema;GAD

Disease

METABOLIC;GAD

Disease

Gastritis;FunDO

Disease

HTLV-I infection;FunDO

Disease

Kidney Failure, Chronic;GAD

Disease

Behcet syndrome;FunDO

Disease

IGA glomerulonephritis;FunDO

Disease

left ventricular dysfunction;GAD

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

chronic obstructive pulmonary disease/COPD;GAD

Disease

endometrial cancer;GAD

Disease

atherosclerosis, carotid;GAD

Disease

Arthritis;FunDO

Disease

Arteriopathy;FunDO

Disease

Alzheimer's disease dementia, vascular;GAD

Disease

Mucocutaneous lymph node syndrome;FunDO

Disease

Pleural effusion, Malignant;FunDO

Disease

Dental plaque;FunDO

Disease

colorectal cancer;GAD

Disease

Pre-Eclampsia;FunDO

Disease

diabetes, type 2;GAD

Disease

brain hemorrhage;GAD

Disease

Ovarian disease;FunDO

Disease

Bronchiolitis obliterans;FunDO

Disease

Keratoconjunctivitis Sicca;FunDO

Disease

Glomerulonephritis;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Hepatitis B;FunDO

Disease

breast cancer;GAD

Disease

Obesity;FunDO

Disease

Atherosclerosis;GAD

Disease

stomach cancer;GAD

Disease

preterm delivery;GAD

Disease

Periodontitis;FunDO

Disease

bladder cancer;GAD

Disease

abdominal aortic aneurysm;GAD

Disease

Esotropia;FunDO

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Cystic fibrosis;FunDO

Disease

VISION;GAD

Disease

Systemic scleroderma;FunDO

Disease

myelopathy/tropical spastic paraparesis;GAD

Disease

Asthma;GAD

Disease

Takayasu's arteritis;FunDO

Disease

periodontitis;GAD

Disease

Stroke;FunDO

Disease

Varicosity;FunDO

Disease

Autoimmune disease;FunDO

Disease

bone density;GAD

Disease

throracic aortic aneurysm throracic aortic dissection;GAD

Disease

Lichen planus;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

Endometriosis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

glaucoma, primary open-angle;GAD

Disease

Growth retardation;FunDO

Disease

Heart failure;FunDO

Disease

Sinusitis;FunDO

Disease

Skin disease;FunDO

Disease

Skin cancer;FunDO

Disease

lung cancer;GAD

Disease

RENAL;GAD

External Links

Links to Entrez Gene

4318

Links to all GeneRIF Items

4318

Links to iHOP

4318

Sequence Information

Nucleotide Sequence

>4318 : length: 2124
atgagcctctggcagcccctggtcctggtgctcctggtgctgggctgctgctttgctgcc
cccagacagcgccagtccacccttgtgctcttccctggagacctgagaaccaatctcacc
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgtggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagaccggtgagctggatagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccacaac
atcacctattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcactgtggagcgcggtgacgccgctcaccttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgacgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcatcttcgagggccgctcc
tactctgcctgcaccaccgacggtcgctccgacggcttgccctggtgcagtaccacggcc
aactacgacaccgacgaccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccgggacaagctcttcggcttctgcccgacccgagctgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcggagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggggccccccttgcataaggacgacgtgaatggcatccgg
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccgacggtctgccccaccggaccccccactgtccacccctcagagcgc
cccacagctggccccacaggtcccccctcagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgatgcctgcaacgtgaacatc
ttcgacgccatcgcggagattgggaaccagctgtatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccccttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtctttgaggagcggctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggagccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccagcgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctacgtgacctatgac
atcctgcagtgccctgaggactag

Protein Sequence

>4318 : length: 707
MSLWQPLVLVLLVLGCCFAAPRQRQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHHN
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLTFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFIFEGRS
YSACTTDGRSDGLPWCSTTANYDTDDRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDRDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRGDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEGPPLHKDDVNGIRHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVHPSER
PTAGPTGPPSAGPTGPPTAGPSTATTVPLSPVDDACNVNIFDAIAEIGNQLYLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEERLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSASEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED



')