Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4316

Name

MMP7

Synonym

MMP-7|MPSL1|PUMP-1;matrix metallopeptidase 7 (matrilysin, uterine);MMP7;matrix metallopeptidase 7 (matrilysin, uterine)

Definition

matrilysin|matrin|matrix metalloproteinase 7 (matrilysin, uterine)|matrix metalloproteinase-7|pump-1 protease|uterine matrilysin|uterine metalloproteinase

Position

11q21-q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Disease

Pulmonary fibrosis;FunDO

Disease

IMMUNE;GAD

Disease

Macular degeneration;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

brain cancer;GAD

Disease

coronary artery luminal dimensions;GAD

Disease

Biliary Atresia;FunDO

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

Oral cancer;FunDO

Disease

rheumatoid arthritis;GAD

Disease

Rabies;FunDO

Disease

Endometriosis;FunDO

Disease

Ulcerative colitis;FunDO

External Links

Links to Entrez Gene

4316

Links to all GeneRIF Items

4316

Links to iHOP

4316

Sequence Information

Nucleotide Sequence

>4316 : length: 804
atgcgactcaccgtgctgtgtgctgtgtgcctgctgcctggcagcctggccctgccgctg
cctcaggaggcgggaggcatgagtgagctacagtgggaacaggctcaggactatctcaag
agattttatctctatgactcagaaacaaaaaatgccaacagtttagaagccaaactcaag
gagatgcaaaaattctttggcctacctataactggaatgttaaactcccgcgtcatagaa
ataatgcagaagcccagatgtggagtgccagatgttgcagaatactcactatttccaaat
agcccaaaatggacttccaaagtggtcacctacaggatcgtatcatatactcgagactta
ccgcatattacagtggatcgattagtgtcaaaggctttaaacatgtggggcaaagagatc
cccctgcatttcaggaaagttgtatggggaactgctgacatcatgattggctttgcgcga
ggagctcatggggactcctacccatttgatgggccaggaaacacgctggctcatgccttt
gcgcctgggacaggtctcggaggagatgctcacttcgatgaggatgaacgctggacggat
ggtagcagtctagggattaacttcctgtatgctgcaactcatgaacttggccattctttg
ggtatgggacattcctctgatcctaatgcagtgatgtatccaacctatggaaatggagat
ccccaaaattttaaactttcccaggatgatattaaaggcattcagaaactatatggaaag
agaagtaattcaagaaagaaatag

Protein Sequence

>4316 : length: 267
MRLTVLCAVCLLPGSLALPLPQEAGGMSELQWEQAQDYLKRFYLYDSETKNANSLEAKLK
EMQKFFGLPITGMLNSRVIEIMQKPRCGVPDVAEYSLFPNSPKWTSKVVTYRIVSYTRDL
PHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAF
APGTGLGGDAHFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD
PQNFKLSQDDIKGIQKLYGKRSNSRKK



')