Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4314

Name

MMP3

Synonym

CHDS6|MMP-3|SL-1|STMY|STMY1|STR1;matrix metallopeptidase 3 (stromelysin 1, progelatinase);MMP3;matrix metallopeptidase 3 (stromelysin 1, progelatinase)

Definition

matrix metalloproteinase 3 (stromelysin 1, progelatinase)|matrix metalloproteinase-3|proteoglycanase|stromelysin-1|transin-1

Position

11q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

p75(NTR)-mediated signaling;PID Curated;200103

Pathway

Plasminogen activating cascade;PANTHER;P00050

Disease

DEVELOPMENTAL;GAD

Disease

Acute Coronary Syndrome;GAD

Disease

Alzheimer's disease;GAD

Disease

Alzheimer's disease dementia, vascular;GAD

Disease

atherosclerosis, coronary unstable coronary syndrome;GAD

Disease

Lung cancer;FunDO

Disease

Periodontitis;FunDO

Disease

cleft lip with cleft palate cleft lip without cleft palate;GAD

Disease

Melanoma;FunDO

Disease

carotid artery atherosclerosis;GAD

Disease

Coronary heart disease, susceptibility to, 6;OMIM

Disease

Polyarthritis;FunDO

Disease

Oral cancer;FunDO

Disease

bladder cancer;GAD

Disease

arthritis;GAD

Disease

Breast cancer;FunDO

Disease

Mucocutaneous lymph node syndrome;FunDO

Disease

Endometriosis;FunDO

Disease

Takayasu's arteritis;FunDO

Disease

Metabolism disease;FunDO

Disease

Ulcerative colitis;FunDO

Disease

Obesity;FunDO

Disease

matrix metalloproteinase-3 concentration myocardial infarct;GAD

Disease

AGING;GAD

Disease

oral cancer oral submucous fibrosis;GAD

Disease

lung cancer;GAD

Disease

atherosclerosis, coronary;GAD

Disease

IMMUNE;GAD

Disease

Parkinson's disease;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

Esophagus cancer;FunDO

Disease

colorectal cancer.;GAD

Disease

head and neck cancer;GAD

Disease

degeneration of intervertebral discs;GAD

Disease

periodontitis;GAD

Disease

rheumatoid arthritis;GAD

Disease

Varicosity;FunDO

Disease

Colon cancer;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Cholangiocarcinoma;FunDO

Disease

aortic stenosis;GAD

Disease

cholangitis, sclerosing;GAD

Disease

Ewings sarcoma;FunDO

Disease

primary sclerosing cholangitis;GAD

Disease

Adenoma;FunDO

Disease

Lichen planus;FunDO

Disease

Coronary Artery Disease;GAD

Disease

Celiac Disease;GAD

Disease

restenosis;GAD

Disease

Stroke;GAD

Disease

Multiple sclerosis;FunDO

Disease

CANCER;GAD

Disease

blood pressure, arterial;GAD

Disease

Liver cancer;FunDO

Disease

Pneumoconiosis;FunDO

Disease

Brain tumor;FunDO

Disease

Thromboangiitis obliterans;FunDO

Disease

kidney cancer;GAD

Disease

Lymphatic metastasis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Necrotizing enterocolitis;FunDO

Disease

Renal Cell cancer;FunDO

Disease

Cirrhosis;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Gouts;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

carotid artery stenosis;GAD

Disease

Enteritis;FunDO

Disease

Chondrosarcoma;FunDO

Disease

Ovarian cancer;FunDO

Disease

Lymphoma;FunDO

Disease

Amyloidosis;FunDO

Disease

left ventricular dysfunction;GAD

Disease

Congenital abnormality;FunDO

Disease

Myocardial Infarction;GAD

Disease

Atherosclerosis;GAD

Disease

colorectal cancer;GAD

Disease

myocardial infarct;GAD

Disease

Crohn's disease ulcerative colitis;GAD

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

4314

Links to all GeneRIF Items

4314

Links to iHOP

4314

Sequence Information

Nucleotide Sequence

>4314 : length: 1434
atgaagagtcttccaatcctactgttgctgtgcgtggcagtttgctcagcctatccattg
gatggagctgcaaggggtgaggacaccagcatgaaccttgttcagaaatatctagaaaac
tactacgacctcaaaaaagatgtgaaacagtttgttaggagaaaggacagtggtcctgtt
gttaaaaaaatccgagaaatgcagaagttccttggattggaggtgacggggaagctggac
tccgacactctggaggtgatgcgcaagcccaggtgtggagttcctgatgttggtcacttc
agaacctttcctggcatcccgaagtggaggaaaacccaccttacatacaggattgtgaat
tatacaccagatttgccaaaagatgctgttgattctgctgttgagaaagctctgaaagtc
tgggaagaggtgactccactcacattctccaggctgtatgaaggagaggctgatataatg
atctcttttgcagttagagaacatggagacttttacccttttgatggacctggaaatgtt
ttggcccatgcctatgcccctgggccagggattaatggagatgcccactttgatgatgat
gaacaatggacaaaggatacaacagggaccaatttatttctcgttgctgctcatgaaatt
ggccactccctgggtctctttcactcagccaacactgaagctttgatgtacccactctat
cactcactcacagacctgactcggttccgcctgtctcaagatgatataaatggcattcag
tccctctatggacctccccctgactcccctgagacccccctggtacccacggaacctgtc
cctccagaacctgggacgccagccaactgtgatcctgctttgtcctttgatgctgtcagc
actctgaggggagaaatcctgatctttaaagacaggcacttttggcgcaaatccctcagg
aagcttgaacctgaattgcatttgatctcttcattttggccatctcttccttcaggcgtg
gatgccgcatatgaagttactagcaaggacctcgttttcatttttaaaggaaatcaattc
tgggctatcagaggaaatgaggtacgagctggatacccaagaggcatccacaccctaggt
ttccctccaaccgtgaggaaaatcgatgcagccatttctgataaggaaaagaacaaaaca
tatttctttgtagaggacaaatactggagatttgatgagaagagaaattccatggagcca
ggctttcccaagcaaatagctgaagactttccagggattgactcaaagattgatgctgtt
tttgaagaatttgggttcttttatttctttactggatcttcacagttggagtttgaccca
aatgcaaagaaagtgacacacactttgaagagtaacagctggcttaattgttga

Protein Sequence

>4314 : length: 477
MKSLPILLLLCVAVCSAYPLDGAARGEDTSMNLVQKYLENYYDLKKDVKQFVRRKDSGPV
VKKIREMQKFLGLEVTGKLDSDTLEVMRKPRCGVPDVGHFRTFPGIPKWRKTHLTYRIVN
YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDFYPFDGPGNV
LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY
HSLTDLTRFRLSQDDINGIQSLYGPPPDSPETPLVPTEPVPPEPGTPANCDPALSFDAVS
TLRGEILIFKDRHFWRKSLRKLEPELHLISSFWPSLPSGVDAAYEVTSKDLVFIFKGNQF
WAIRGNEVRAGYPRGIHTLGFPPTVRKIDAAISDKEKNKTYFFVEDKYWRFDEKRNSMEP
GFPKQIAEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLNC



')