Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4313

Name

MMP2

Synonym

CLG4|CLG4A|MMP-II|MONA|TBE-1;matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase);MMP2;matrix metallopeptidase 2 (gelatinase A, 72kDa gelatinase, 72kDa type IV collagenase)

Definition

72 kDa gelatinase|72 kDa type IV collagenase|MMP-2|collagenase type IV-A|gelatinase A|matrix metalloproteinase-2|matrix metalloproteinase-II|neutrophil gelatinase

Position

16q13-q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

LPA receptor mediated events;PID Curated;200011

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

inhibition of matrix metalloproteinases;PID BioCarta;100045

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

ATF-2 transcription factor network;PID Curated;200116

Pathway

FOXM1 transcription factor network;PID Curated;200120

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Pathway

Bladder cancer;KEGG PATHWAY;hsa05219

Pathway

amb2 Integrin signaling;PID Curated;200108

Disease

Vasculitis;FunDO

Disease

gastric cardia adenocarcinoma;GAD

Disease

oral submucous fibrosis;GAD

Disease

Cardiovascular disease;FunDO

Disease

Periodontitis;FunDO

Disease

Degenerative disc disease;FunDO

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

bladder cancer;GAD

Disease

Uterine disease;FunDO

Disease

abdominal aortic aneurysm;GAD

Disease

Muscular dystrophy;FunDO

Disease

Helicobacter infection;FunDO

Disease

Obesity;FunDO

Disease

psoriasis;GAD

Disease

Emphysema;FunDO

Disease

Chronic rejection of renal transplant;FunDO

Disease

lung cancer;GAD

Disease

atherosclerosis, coronary;GAD

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

Huntington disease;FunDO

Disease

Pulmonary fibrosis;FunDO

Disease

prostate cancer;GAD

Disease

Polycystic ovary syndrome;FunDO

Disease

Choriocarcinoma;KEGG DISEASE;H00028

Disease

Systemic infection;FunDO

Disease

Takayasu's arteritis;FunDO

Disease

Ptosis;FunDO

Disease

osteoarthritis;GAD

Disease

rheumatoid arthritis;GAD

Disease

esophageal cancer;GAD

Disease

colorectal cancer;GAD

Disease

METABOLIC;GAD

Disease

Capillaries disease;FunDO

Disease

Hamman-Rich syndrome;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Bronchopulmonary dysplasia;FunDO

Disease

Lichen planus;FunDO

Disease

Heart Failure;GAD

Disease

CARDIOVASCULAR;GAD

Disease

nasopharyngeal cancer;GAD

Disease

Glomerulonephritis;FunDO

Disease

Behcet syndrome;FunDO

Disease

Atherosclerosis;GAD

Disease

Cancers of the breast and female genital organs;KEGG DISEASE

Disease

CNS metastases;FunDO

Disease

gastric cardia adenocarcinoma and esophageal squamous cell carcinoma;GAD

Disease

Acne;FunDO

Disease

Growth retardation;FunDO

Disease

Cancers;KEGG DISEASE

Disease

Hepatitis B;FunDO

Disease

Sinusitis;FunDO

Disease

Bone disease;FunDO

Disease

breast cancer;GAD

Disease

CANCER;GAD

Disease

Transient hypertension of pregnancy;FunDO

Disease

Skin cancer;FunDO

Disease

Torg-Winchester syndrome;OMIM

Disease

oral cancer;GAD

Disease

stomach cancer;GAD

Disease

Arthritis;FunDO

External Links

Links to Entrez Gene

4313

Links to all GeneRIF Items

4313

Links to iHOP

4313

Sequence Information

Nucleotide Sequence

>4313 : length: 1833
atgcaatacctgaacaccttctatggctgccccaaggagagctgcaacctgtttgtgctg
aaggacacactaaagaagatgcagaagttctttggactgccccagacaggtgatcttgac
cagaataccatcgagaccatgcggaagccacgctgcggcaacccagatgtggccaactac
aacttcttccctcgcaagcccaagtgggacaagaaccagatcacatacaggatcattggc
tacacacctgatctggacccagagacagtggatgatgcctttgctcgtgccttccaagtc
tggagcgatgtgaccccactgcggttttctcgaatccatgatggagaggcagacatcatg
atcaactttggccgctgggagcatggcgatggatacccctttgacggtaaggacggactc
ctggctcatgccttcgccccaggcactggtgttgggggagactcccattttgatgacgat
gagctatggaccttgggagaaggccaagtggtccgtgtgaagtatgggaacgccgatggg
gagtactgcaagttccccttcttgttcaatggcaaggagtacaacagctgcactgatacc
ggccgcagcgatggcttcctctggtgctccaccacctacaactttgagaaggatggcaag
tacggcttctgtccccatgaagccctgttcaccatgggcggcaacgctgaaggacagccc
tgcaagtttccattccgcttccagggcacatcctatgacagctgcaccactgagggccgc
acggatggctaccgctggtgcggcaccactgaggactacgaccgcgacaagaagtatggc
ttctgccctgagaccgccatgtccactgttggtgggaactcagaaggtgccccctgtgtc
ttccccttcactttcctgggcaacaaatatgagagctgcaccagcgccggccgcagtgac
ggaaagatgtggtgtgcgaccacagccaactacgatgatgaccgcaagtggggcttctgc
cctgaccaagggtacagcctgttcctcgtggcagcccacgagtttggccacgccatgggg
ctggagcactcccaagaccctggggccctgatggcacccatttacacctacaccaagaac
ttccgtctgtcccaggatgacatcaagggcattcaggagctctatggggcctctcctgac
attgaccttggcaccggccccacccccacgctgggccctgtcactcctgagatctgcaaa
caggacattgtatttgatggcatcgctcagatccgtggtgagatcttcttcttcaaggac
cggttcatttggcggactgtgacgccacgtgacaagcccatggggcccctgctggtggcc
acattctggcctgagctcccggaaaagattgatgcggtatacgaggccccacaggaggag
aaggctgtgttctttgcagggaatgaatactggatctactcagccagcaccctggagcga
gggtaccccaagccactgaccagcctgggactgccccctgatgtccagcgagtggatgcc
gcctttaactggagcaaaaacaagaagacatacatctttgctggagacaaattctggaga
tacaatgaggtgaagaagaaaatggatcctggcttccccaagctcatcgcagatgcctgg
aatgccatccccgataacctggatgccgtcgtggacctgcagggcggcggtcacagctac
ttcttcaagggtgcctattacctgaagctggagaaccaaagtctgaagagcgtgaagttt
ggaagcatcaaatccgactggctaggctgctga

Protein Sequence

>4313 : length: 610
MQYLNTFYGCPKESCNLFVLKDTLKKMQKFFGLPQTGDLDQNTIETMRKPRCGNPDVANY
NFFPRKPKWDKNQITYRIIGYTPDLDPETVDDAFARAFQVWSDVTPLRFSRIHDGEADIM
INFGRWEHGDGYPFDGKDGLLAHAFAPGTGVGGDSHFDDDELWTLGEGQVVRVKYGNADG
EYCKFPFLFNGKEYNSCTDTGRSDGFLWCSTTYNFEKDGKYGFCPHEALFTMGGNAEGQP
CKFPFRFQGTSYDSCTTEGRTDGYRWCGTTEDYDRDKKYGFCPETAMSTVGGNSEGAPCV
FPFTFLGNKYESCTSAGRSDGKMWCATTANYDDDRKWGFCPDQGYSLFLVAAHEFGHAMG
LEHSQDPGALMAPIYTYTKNFRLSQDDIKGIQELYGASPDIDLGTGPTPTLGPVTPEICK
QDIVFDGIAQIRGEIFFFKDRFIWRTVTPRDKPMGPLLVATFWPELPEKIDAVYEAPQEE
KAVFFAGNEYWIYSASTLERGYPKPLTSLGLPPDVQRVDAAFNWSKNKKTYIFAGDKFWR
YNEVKKKMDPGFPKLIADAWNAIPDNLDAVVDLQGGGHSYFFKGAYYLKLENQSLKSVKF
GSIKSDWLGC



')