Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4233

Name

MET

Synonym

AUTS9|HGFR|RCCP2|c-Met;met proto-oncogene (hepatocyte growth factor receptor);MET;met proto-oncogene (hepatocyte growth factor receptor)

Definition

HGF receptor|HGF/SF receptor|SF receptor|hepatocyte growth factor receptor|met proto-oncogene tyrosine kinase|oncogene MET|proto-oncogene c-Met|scatter factor receptor|tyrosine-protein kinase Met

Position

7q31

Gene Type

protein-coding

Pathways and Diseases

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Regulation of retinoblastoma protein;PID Curated;200191

Pathway

Signaling events mediated by Hepatocyte Growth Factor Receptor (c-Met);PID Curated;200032

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

Epithelial cell signaling in Helicobacter pylori infection;KEGG PATHWAY;hsa05120

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Renal cell carcinoma;KEGG PATHWAY;hsa05211

Pathway

FGF signaling pathway;PID Curated;200189

Disease

Cholangiocarcinoma;KEGG DISEASE;H00046

Disease

Gastric cancer;KEGG DISEASE;H00018

Disease

Cancer;FunDO

Disease

Cerebellar disease;FunDO

Disease

Pervasive development disorder;FunDO

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Hepatocellular carcinoma, childhood type;OMIM

Disease

Emphysema;FunDO

Disease

Pancreatitis;FunDO

Disease

IMMUNE;GAD

Disease

Systemic scleroderma;FunDO

Disease

METABOLIC;GAD

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

Renal cell carcinoma, papillary, familial and sporadic;OMIM

Disease

Autistic disorder;FunDO

Disease

diabetes, type 2;GAD

Disease

PSYCH;GAD

Disease

multiple sclerosis (severity);GAD

Disease

Autism, suseptibility to, 9;OMIM

Disease

Fatty liver;FunDO

Disease

Malaria;FunDO

Disease

Renal cell carcinoma;KEGG DISEASE;H00021

Disease

Cancers;KEGG DISEASE

Disease

Multiple sclerosis (severity);NHGRI

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Autism;GAD

External Links

Links to Entrez Gene

4233

Links to all GeneRIF Items

4233

Links to iHOP

4233

Sequence Information

Nucleotide Sequence

>4233 : length: 4173
atgaaggcccccgctgtgcttgcacctggcatcctcgtgctcctgtttaccttggtgcag
aggagcaatggggagtgtaaagaggcactagcaaagtccgagatgaatgtgaatatgaag
tatcagcttcccaacttcaccgcggaaacacccatccagaatgtcattctacatgagcat
cacattttccttggtgccactaactacatttatgttttaaatgaggaagaccttcagaag
gttgctgagtacaagactgggcctgtgctggaacacccagattgtttcccatgtcaggac
tgcagcagcaaagccaatttatcaggaggtgtttggaaagataacatcaacatggctcta
gttgtcgacacctactatgatgatcaactcattagctgtggcagcgtcaacagagggacc
tgccagcgacatgtctttccccacaatcatactgctgacatacagtcggaggttcactgc
atattctccccacagatagaagagcccagccagtgtcctgactgtgtggtgagcgccctg
ggagccaaagtcctttcatctgtaaaggaccggttcatcaacttctttgtaggcaatacc
ataaattcttcttatttcccagatcatccattgcattcgatatcagtgagaaggctaaag
gaaacgaaagatggttttatgtttttgacggaccagtcctacattgatgttttacctgag
ttcagagattcttaccccattaagtatgtccatgcctttgaaagcaacaattttatttac
ttcttgacggtccaaagggaaactctagatgctcagacttttcacacaagaataatcagg
ttctgttccataaactctggattgcattcctacatggaaatgcctctggagtgtattctc
acagaaaagagaaaaaagagatccacaaagaaggaagtgtttaatatacttcaggctgcg
tatgtcagcaagcctggggcccagcttgctagacaaataggagccagcctgaatgatgac
attcttttcggggtgttcgcacaaagcaagccagattctgccgaaccaatggatcgatct
gccatgtgtgcattccctatcaaatatgtcaacgacttcttcaacaagatcgtcaacaaa
aacaatgtgagatgtctccagcatttttacggacccaatcatgagcactgctttaatagg
acacttctgagaaattcatcaggctgtgaagcgcgccgtgatgaatatcgaacagagttt
accacagctttgcagcgcgttgacttattcatgggtcaattcagcgaagtcctcttaaca
tctatatccaccttcattaaaggagacctcaccatagctaatcttgggacatcagagggt
cgcttcatgcaggttgtggtttctcgatcaggaccatcaacccctcatgtgaattttctc
ctggactcccatccagtgtctccagaagtgattgtggagcatacattaaaccaaaatggc
tacacactggttatcactgggaagaagatcacgaagatcccattgaatggcttgggctgc
agacatttccagtcctgcagtcaatgcctctctgccccaccctttgttcagtgtggctgg
tgccacgacaaatgtgtgcgatcggaggaatgcctgagcgggacatggactcaacagatc
tgtctgcctgcaatctacaaggttttcccaaatagtgcaccccttgaaggagggacaagg
ctgaccatatgtggctgggactttggatttcggaggaataataaatttgatttaaagaaa
actagagttctccttggaaatgagagctgcaccttgactttaagtgagagcacgatgaat
acattgaaatgcacagttggtcctgccatgaataagcatttcaatatgtccataattatt
tcaaatggccacgggacaacacaatacagtacattctcctatgtggatcctgtaataaca
agtatttcgccgaaatacggtcctatggctggtggcactttacttactttaactggaaat
tacctaaacagtgggaattctagacacatttcaattggtggaaaaacatgtactttaaaa
agtgtgtcaaacagtattcttgaatgttataccccagcccaaaccatttcaactgagttt
gctgttaaattgaaaattgacttagccaaccgagagacaagcatcttcagttaccgtgaa
gatcccattgtctatgaaattcatccaaccaaatcttttattagtggtgggagcacaata
acaggtgttgggaaaaacctgaattcagttagtgtcccgagaatggtcataaatgtgcat
gaagcaggaaggaactttacagtggcatgtcaacatcgctctaattcagagataatctgt
tgtaccactccttccctgcaacagctgaatctgcaactccccctgaaaaccaaagccttt
ttcatgttagatgggatcctttccaaatactttgatctcatttatgtacataatcctgtg
tttaagccttttgaaaagccagtgatgatctcaatgggcaatgaaaatgtactggaaatt
aagggaaatgatattgaccctgaagcagttaaaggtgaagtgttaaaagttggaaataag
agctgtgagaatatacacttacattctgaagccgttttatgcacggtccccaatgacctg
ctgaaattgaacagcgagctaaatatagagtggaagcaagcaatttcttcaaccgtcctt
ggaaaagtaatagttcaaccagatcagaatttcacaggattgattgctggtgttgtctca
atatcaacagcactgttattactacttgggtttttcctgtggctgaaaaagagaaagcaa
attaaagatctgggcagtgaattagttcgctacgatgcaagagtacacactcctcatttg
gataggcttgtaagtgcccgaagtgtaagcccaactacagaaatggtttcaaatgaatct
gtagactaccgagctacttttccagaagatcagtttcctaattcatctcagaacggttca
tgccgacaagtgcagtatcctctgacagacatgtcccccatcctaactagtggggactct
gatatatccagtccattactgcaaaatactgtccacattgacctcagtgctctaaatcca
gagctggtccaggcagtgcagcatgtagtgattgggcccagtagcctgattgtgcatttc
aatgaagtcataggaagagggcattttggttgtgtatatcatgggactttgttggacaat
gatggcaagaaaattcactgtgctgtgaaatccttgaacagaatcactgacataggagaa
gtttcccaatttctgaccgagggaatcatcatgaaagattttagtcatcccaatgtcctc
tcgctcctgggaatctgcctgcgaagtgaagggtctccgctggtggtcctaccatacatg
aaacatggagatcttcgaaatttcattcgaaatgagactcataatccaactgtaaaagat
cttattggctttggtcttcaagtagccaaaggcatgaaatatcttgcaagcaaaaagttt
gtccacagagacttggctgcaagaaactgtatgctggatgaaaaattcacagtcaaggtt
gctgattttggtcttgccagagacatgtatgataaagaatactatagtgtacacaacaaa
acaggtgcaaagctgccagtgaagtggatggctttggaaagtctgcaaactcaaaagttt
accaccaagtcagatgtgtggtcctttggcgtgctcctctgggagctgatgacaagagga
gccccaccttatcctgacgtaaacacctttgatataactgtttacttgttgcaagggaga
agactcctacaacccgaatactgcccagaccccttatatgaagtaatgctaaaatgctgg
caccctaaagccgaaatgcgcccatccttttctgaactggtgtcccggatatcagcgatc
ttctctactttcattggggagcactatgtccatgtgaacgctacttatgtgaacgtaaaa
tgtgtcgctccgtatccttctctgttgtcatcagaagataacgctgatgatgaggtggac
acacgaccagcctccttctgggagacatcatag

Protein Sequence

>4233 : length: 1390
MKAPAVLAPGILVLLFTLVQRSNGECKEALAKSEMNVNMKYQLPNFTAETPIQNVILHEH
HIFLGATNYIYVLNEEDLQKVAEYKTGPVLEHPDCFPCQDCSSKANLSGGVWKDNINMAL
VVDTYYDDQLISCGSVNRGTCQRHVFPHNHTADIQSEVHCIFSPQIEEPSQCPDCVVSAL
GAKVLSSVKDRFINFFVGNTINSSYFPDHPLHSISVRRLKETKDGFMFLTDQSYIDVLPE
FRDSYPIKYVHAFESNNFIYFLTVQRETLDAQTFHTRIIRFCSINSGLHSYMEMPLECIL
TEKRKKRSTKKEVFNILQAAYVSKPGAQLARQIGASLNDDILFGVFAQSKPDSAEPMDRS
AMCAFPIKYVNDFFNKIVNKNNVRCLQHFYGPNHEHCFNRTLLRNSSGCEARRDEYRTEF
TTALQRVDLFMGQFSEVLLTSISTFIKGDLTIANLGTSEGRFMQVVVSRSGPSTPHVNFL
LDSHPVSPEVIVEHTLNQNGYTLVITGKKITKIPLNGLGCRHFQSCSQCLSAPPFVQCGW
CHDKCVRSEECLSGTWTQQICLPAIYKVFPNSAPLEGGTRLTICGWDFGFRRNNKFDLKK
TRVLLGNESCTLTLSESTMNTLKCTVGPAMNKHFNMSIIISNGHGTTQYSTFSYVDPVIT
SISPKYGPMAGGTLLTLTGNYLNSGNSRHISIGGKTCTLKSVSNSILECYTPAQTISTEF
AVKLKIDLANRETSIFSYREDPIVYEIHPTKSFISGGSTITGVGKNLNSVSVPRMVINVH
EAGRNFTVACQHRSNSEIICCTTPSLQQLNLQLPLKTKAFFMLDGILSKYFDLIYVHNPV
FKPFEKPVMISMGNENVLEIKGNDIDPEAVKGEVLKVGNKSCENIHLHSEAVLCTVPNDL
LKLNSELNIEWKQAISSTVLGKVIVQPDQNFTGLIAGVVSISTALLLLLGFFLWLKKRKQ
IKDLGSELVRYDARVHTPHLDRLVSARSVSPTTEMVSNESVDYRATFPEDQFPNSSQNGS
CRQVQYPLTDMSPILTSGDSDISSPLLQNTVHIDLSALNPELVQAVQHVVIGPSSLIVHF
NEVIGRGHFGCVYHGTLLDNDGKKIHCAVKSLNRITDIGEVSQFLTEGIIMKDFSHPNVL
SLLGICLRSEGSPLVVLPYMKHGDLRNFIRNETHNPTVKDLIGFGLQVAKGMKYLASKKF
VHRDLAARNCMLDEKFTVKVADFGLARDMYDKEYYSVHNKTGAKLPVKWMALESLQTQKF
TTKSDVWSFGVLLWELMTRGAPPYPDVNTFDITVYLLQGRRLLQPEYCPDPLYEVMLKCW
HPKAEMRPSFSELVSRISAIFSTFIGEHYVHVNATYVNVKCVAPYPSLLSSEDNADDEVD
TRPASFWETS



')