Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4216

Name

MAP3K4

Synonym

MAPKKK4|MEKK4|MTK1|PRO0412;mitogen-activated protein kinase kinase kinase 4;MAP3K4;mitogen-activated protein kinase kinase kinase 4

Definition

MAP three kinase 1|MAP/ERK kinase kinase 4|MAPK/ERK kinase kinase 4|MEK kinase 4|MEKK 4|SSK2/SSK22 MAP kinase kinase kinase, yeast, homolog of|dJ473J16.1 (mitogen-activated protein kinase kinase kinase 4)|predicted protein of HQ0412

Position

6q26

Gene Type

protein-coding

Pathways and Diseases

Pathway

mapkinase signaling pathway;PID BioCarta;100113

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

Ras Pathway;PANTHER;P04393

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

FGF signaling pathway;PANTHER;P00021

Disease

Embryoma;FunDO

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

4216

Links to all GeneRIF Items

4216

Links to iHOP

4216

Sequence Information

Nucleotide Sequence

>4216 : length: 4827
atgagagaagccgctgccgcgctggtccctcctcccgcctttgccgtcacgcctgccgcc
gccatggaggagccgccgccaccgccgccgccgccaccaccgccaccggaacccgagacc
gagtcagaacccgagtgctgcttggcggcgaggcaagagggcacattgggagattcagct
tgcaagagtcctgaatctgatctagaagacttctccgatgaaacaaatacagagaatctt
tatggtacctctccccccagcacacctcgacagatgaaacgcatgtcaaccaaacatcag
aggaataatgtggggaggccagccagtcggtctaatttgaaagaaaaaatgaatgcacca
aatcagcctccacataaagacactggaaaaacagtggagaatgtggaagaatacagctat
aagcaggagaaaaagatccgagcagctcttagaacaacagagcgtgatcataaaaaaaat
gtacagtgctcattcatgttagactcagtgggtggatctttgccaaaaaaatcaattcca
gatgtggatctcaataagccttacctcagccttggctgtagcaatgctaagcttccagta
tctgtgcccatgcctatagccagacctgcacgccagacttctaggactgactgtccagca
gatcgtttaaagttttttgaaactttacgacttttgctaaagcttacctcagtctcaaag
aaaaaagacagggagcaaagaggacaagaaaatacgtctggtttctggcttaaccgatct
aacgaactgatctggttagagctacaagcctggcatgcaggacggacaattaacgaccag
gacttctttttatatacagcccgtcaagccatcccagatattattaatgaaatccttact
ttcaaagtcgactatgggagcttcgcctttgttagagatagagctggttttaatggtact
tcagtagaagggcagtgcaaagccactcctggaacaaagattgtaggttactcaacacat
catgagcatctccaacgccagagggtctcatttgagcaggtaaaacggataatggagctg
ctagagtacatagaagcactttatccatcattgcaggctcttcagaaggactatgaaaaa
tatgctgcaaaagacttccaggacagggtgcaggcactctgtttgtggttaaacatcaca
aaagacttaaatcagaaattaaggattatgggcactgttttgggcatcaagaatttatca
gacattggctggccagtgtttgaaatcccttcccctcgaccatccaaaggtaatgagccg
gagtatgagggtgatgacacagaaggagaattaaaggagttggaaagtagtacggatgag
agtgaagaagaacaaatctctgatcctagggtaccggaaatcagacagcccatagataac
agcttcgacatccagtcgcgggactgcatatccaagaagcttgagaggctcgaatctgag
gatgattctcttggctggggagcaccagactggagcacagaagcaggctttagtagacat
tgtctgacttctatttatagaccatttgtagacaaagcactgaagcagatggggttaaga
aagttaattttaagacttcacaagctaatggatggttccttgcaaagggcacgtatagca
ttggtaaagaacgatcgtccagtggagttttctgaatttccagatcccatgtggggttca
gattatgtgcagttgtcaaggacaccaccttcatctgaggagaaatgcagtgctgtgtcg
tgggaggagctgaaggccatggatttaccttcattcgaacctgccttcctagttctctgc
cgagtccttctgaatgtcatacatgagtgtctgaagttaagattggagcagagacctgct
ggagaaccatctctcttgagtattaagcagctggtgagagagtgtaaggaggtcctgaag
ggcggcctgctgatgaagcagtactaccagttcatgctgcaggaggttctggaggacttg
gagaagcccgactgcaacattgacgcttttgaagaggatctacataaaatgcttatggtg
tattttgattacatgagaagctggatccaaatgctacagcaattacctcaagcatcgcat
agtttaaaaaatctgttagaagaagaatggaatttcaccaaagaaataactcattacata
cggggaggagaagcacaggccgggaagcttttctgtgacattgcaggaatgctgctgaaa
tctacaggaagttttttagaatttggcttacaggagagctgtgctgaattttggactagt
gcggatgacagcagtgcttccgacgaaatcaggaggtctgttatagagatcagtcgagcc
ctgaaggagctcttccatgaagccagagaaagggcttccaaagcacttggatttgctaaa
atgttgagaaaggacctggaaatagcagcagaattcaggctttcagccccagttagagac
ctcctggatgttctgaaatcaaaacagtatgtcaaggtgcaaattcctgggttagaaaac
ttgcaaatgtttgttccagacactcttgctgaggagaagagtattattttgcagttactc
aatgcagctgcaggaaaggactgttcaaaagattcagatgacgtactcatcgatgcctat
ctgcttctgaccaagcacggtgatcgagcccgtgattcagaggacagctggggcacctgg
gaggcacagcctgtcaaagtcgtgcctcaggtggagactgttgacaccctgagaagcatg
caggtggataatcttttactagttgtcatgcagtctgcgcatctcacaattcagagaaaa
gctttccagcagtccattgagggacttatgactctgtgccaggagcagacatccagtcag
ccggtcatcgccaaagctttgcagcagctgaagaatgatgcattggagctatgcaacagg
ataagcaatgccattgaccgcgtggaccacatgttcacatcagaatttgatgctgaggtt
gatgaatctgaatctgtcaccttgcaacagtactaccgagaagcaatgattcaggggtac
aattttggatttgagtatcataaagaagttgttcgtttgatgtctggggagtttagacag
aagataggagacaaatatataagctttgcccggaagtggatgaattatgtcctgactaaa
tgtgagagtggtagaggtacaagacccaggtgggcgactcaaggatttgattttctacaa
gcaattgaacctgcctttatttcagctttaccagaagatgacttcttgagtttacaagcc
ttgatgaatgaatgcattggccatgtcataggaaaaccacacagtcctgttacaggtttg
taccttgccattcatcggaacagcccccgtcctatgaaggtacctcgatgccatagtgac
cctcctaacccacacctcattatccccactccagagggattcagcactcggagcatgcct
tccgacgcgcggagccatggcagccctgctgctgctgctgctgctgctgctgctgctgtt
gctgccagtcggcccagcccctctggtggtgactctgtgctgcccaaatccatcagcagt
gcccatgataccaggggttccagcgttcctgaaaatgatcgattggcttccatagctgct
gaattgcagtttaggtccctgagtcgtcactcaagccccacggaggagcgagatgaacca
gcatatccaagaggagattcaagtgggtccacaagaagaagttgggaacttcggacacta
atcagccagagtaaagatactgcttctaaactaggacccatagaagctatccagaagtca
gtccgattgtttgaagaaaagaggtaccgagaaatgaggagaaagaatatcattggtcaa
gtttgtgatacgcctaagtcctatgataatgttatgcacgttggcttgaggaaggtgacc
ttcaaatggcaaagaggaaacaaaattggagaaggccagtatgggaaggtgtacacctgc
atcagcgtcgacaccggggagctgatggccatgaaagagattcgatttcaacctaatgac
cataagactatcaaggaaactgcagacgaattgaaaatattcgaaggcatcaaacacccc
aatctggttcggtattttggtgtggagctccatagagaagaaatgtacatcttcatggag
tactgcgatgaggggactttagaagaggtgtcaaggctgggacttcaggaacatgtgatt
aggctgtattcaaagcagatcaccattgcgatcaacgtcctccatgagcatggcatagtc
caccgtgacattaaaggtgccaatatcttccttacctcatctggattaatcaaactggga
gattttggatgttcagtaaagctcaaaaacaatgcccagaccatgcctggtgaagtgaac
agcaccctggggacagcagcatacatggcacctgaagtcatcactcgtgccaaaggagag
ggccatgggcgtgcggccgacatctggagtctggggtgtgttgtcatagagatggtgact
ggcaagaggccttggcatgagtatgagcacaactttcaaattatgtataaagtggggatg
ggacataagccaccaatccctgaaagattaagccctgaaggaaaggacttcctttctcac
tgccttgagagtgacccaaagatgagatggaccgccagccagctcctcgaccattcgttt
gtcaaggtttgcacagatgaagaatga

Protein Sequence

>4216 : length: 1608
MREAAAALVPPPAFAVTPAAAMEEPPPPPPPPPPPPEPETESEPECCLAARQEGTLGDSA
CKSPESDLEDFSDETNTENLYGTSPPSTPRQMKRMSTKHQRNNVGRPASRSNLKEKMNAP
NQPPHKDTGKTVENVEEYSYKQEKKIRAALRTTERDHKKNVQCSFMLDSVGGSLPKKSIP
DVDLNKPYLSLGCSNAKLPVSVPMPIARPARQTSRTDCPADRLKFFETLRLLLKLTSVSK
KKDREQRGQENTSGFWLNRSNELIWLELQAWHAGRTINDQDFFLYTARQAIPDIINEILT
FKVDYGSFAFVRDRAGFNGTSVEGQCKATPGTKIVGYSTHHEHLQRQRVSFEQVKRIMEL
LEYIEALYPSLQALQKDYEKYAAKDFQDRVQALCLWLNITKDLNQKLRIMGTVLGIKNLS
DIGWPVFEIPSPRPSKGNEPEYEGDDTEGELKELESSTDESEEEQISDPRVPEIRQPIDN
SFDIQSRDCISKKLERLESEDDSLGWGAPDWSTEAGFSRHCLTSIYRPFVDKALKQMGLR
KLILRLHKLMDGSLQRARIALVKNDRPVEFSEFPDPMWGSDYVQLSRTPPSSEEKCSAVS
WEELKAMDLPSFEPAFLVLCRVLLNVIHECLKLRLEQRPAGEPSLLSIKQLVRECKEVLK
GGLLMKQYYQFMLQEVLEDLEKPDCNIDAFEEDLHKMLMVYFDYMRSWIQMLQQLPQASH
SLKNLLEEEWNFTKEITHYIRGGEAQAGKLFCDIAGMLLKSTGSFLEFGLQESCAEFWTS
ADDSSASDEIRRSVIEISRALKELFHEARERASKALGFAKMLRKDLEIAAEFRLSAPVRD
LLDVLKSKQYVKVQIPGLENLQMFVPDTLAEEKSIILQLLNAAAGKDCSKDSDDVLIDAY
LLLTKHGDRARDSEDSWGTWEAQPVKVVPQVETVDTLRSMQVDNLLLVVMQSAHLTIQRK
AFQQSIEGLMTLCQEQTSSQPVIAKALQQLKNDALELCNRISNAIDRVDHMFTSEFDAEV
DESESVTLQQYYREAMIQGYNFGFEYHKEVVRLMSGEFRQKIGDKYISFARKWMNYVLTK
CESGRGTRPRWATQGFDFLQAIEPAFISALPEDDFLSLQALMNECIGHVIGKPHSPVTGL
YLAIHRNSPRPMKVPRCHSDPPNPHLIIPTPEGFSTRSMPSDARSHGSPAAAAAAAAAAV
AASRPSPSGGDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEP
AYPRGDSSGSTRRSWELRTLISQSKDTASKLGPIEAIQKSVRLFEEKRYREMRRKNIIGQ
VCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCISVDTGELMAMKEIRFQPND
HKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGTLEEVSRLGLQEHVI
RLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKLKNNAQTMPGEVN
STLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQIMYKVGM
GHKPPIPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVKVCTDEE



')