Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4215

Name

MAP3K3

Synonym

MAPKKK3|MEKK3;mitogen-activated protein kinase kinase kinase 3;MAP3K3;mitogen-activated protein kinase kinase kinase 3

Definition

MAP/ERK kinase kinase 3|MAPK/ERK kinase kinase 3|MEK kinase 3|MEKK 3

Position

17q23.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

p38 MAPK signaling pathway;PID Curated;200014

Pathway

Regulation of p38-alpha and p38-beta;PID Curated;200054

Pathway

Neurotrophin signaling pathway;KEGG PATHWAY;hsa04722

Pathway

B cell activation;PANTHER;P00010

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

Oxidative stress response;PANTHER;P00046

Pathway

EGF receptor signaling pathway;PANTHER;P00018

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

GnRH signaling pathway;KEGG PATHWAY;hsa04912

Pathway

FGF signaling pathway;PANTHER;P00021

Disease

Height;NHGRI

Disease

DEVELOPMENTAL;GAD

Disease

height;GAD

External Links

Links to Entrez Gene

4215

Links to all GeneRIF Items

4215

Links to iHOP

4215

Sequence Information

Nucleotide Sequence

>4215 : length: 1881
atggacgaacaggaggcattgaactcaatcatgaacgatctggtggccctccagatgaac
cgacgtcaccggatgcctggatatgagaccatgaagaacaaagacacaggtcactcaaat
aggcagagtgacgtcagaatcaagttcgagcacaacggggagaggcgaattatagcgttc
agccggcctgtgaaatatgaagatgtggagcacaaggtgacaacagtatttggacaacct
cttgatctacattacatgaacaatgagctctccatcctgctgaaaaaccaagatgatctt
gataaagcaattgacattttagatagaagctcaagcatgaaaagccttaggatattgctg
ttgtcccaggacagaaaccataacagttcctctccccactctggggtgtccagacaggtg
cggatcaaggcttcccagtccgcaggggatataaatactatctaccagccccccgagccc
agaagcaggcacctctctgtcagctcccagaaccctggccgaagctcacctccccctggc
tatgttcctgagcggcagcagcacattgcccggcaggggtcctacaccagcatcaacagt
gagggggagttcatcccagagaccagcgagcagtgcatgctggatcccctgagcagtgca
gaaaattccttgtctggaagctgccaatccttggacaggtcagcagacagcccatccttc
cggaaatcacgaatgtcccgtgcccagagcttccctgacaacagacaggaatactcagat
cgggaaactcagctttatgacaaaggggtcaaaggtggaacctacccccggcgctaccac
gtgtctgtgcaccacaaggactacagtgatggcagaagaacatttccccgaatacggcgt
catcaaggcaacttgttcaccctggtgccctccagccgctccctgagcacaaatggcgag
aacatgggtctggctgtgcaatacctggacccccgtgggcgcctgcggagtgcggacagc
gagaatgccctctctgtgcaggagaggaatgtgccaaccaagtctcccagtgcccccatc
aactggcgccggggaaagctcctgggccagggtgccttcggcagggtctatttgtgctat
gacgtggacacgggacgtgaacttgcttccaagcaggtccaatttgatccagacagtcct
gagacaagcaaggaggtgagtgctctggagtgcgagatccagttgctaaagaacttgcag
catgagcgcatcgtgcagtactatggctgtctgcgggaccgcgctgagaagaccctgacc
atcttcatggagtacatgccagggggctcggtgaaagaccagttgaaggcttacggtgct
ctgacagagagcgtgacccgaaagtacacgcggcagatcctggagggcatgtcctacctg
cacagcaacatgattgttcaccgggacattaagggagccaacatcctccgagactctgct
gggaatgtaaagctgggggactttggggccagcaaacgcctgcagacgatctgtatgtcg
gggacgggcatgcgctccgtcactggcacaccctactggatgagccctgaggtgatcagc
ggcgagggctatggaaggaaagcagacgtgtggagcctgggctgcactgtggtggagatg
ctgacagagaaaccaccgtgggcagagtatgaagctatggccgccatcttcaagattgcc
acccagcccaccaatcctcagctgccctcccacatctctgaacatggccgggacttcctg
aggcgcatttttgtggaggctcgccagagaccttcagctgaggagctgctcacacaccac
tttgcacagctcatgtactga

Protein Sequence

>4215 : length: 626
MDEQEALNSIMNDLVALQMNRRHRMPGYETMKNKDTGHSNRQSDVRIKFEHNGERRIIAF
SRPVKYEDVEHKVTTVFGQPLDLHYMNNELSILLKNQDDLDKAIDILDRSSSMKSLRILL
LSQDRNHNSSSPHSGVSRQVRIKASQSAGDINTIYQPPEPRSRHLSVSSQNPGRSSPPPG
YVPERQQHIARQGSYTSINSEGEFIPETSEQCMLDPLSSAENSLSGSCQSLDRSADSPSF
RKSRMSRAQSFPDNRQEYSDRETQLYDKGVKGGTYPRRYHVSVHHKDYSDGRRTFPRIRR
HQGNLFTLVPSSRSLSTNGENMGLAVQYLDPRGRLRSADSENALSVQERNVPTKSPSAPI
NWRRGKLLGQGAFGRVYLCYDVDTGRELASKQVQFDPDSPETSKEVSALECEIQLLKNLQ
HERIVQYYGCLRDRAEKTLTIFMEYMPGGSVKDQLKAYGALTESVTRKYTRQILEGMSYL
HSNMIVHRDIKGANILRDSAGNVKLGDFGASKRLQTICMSGTGMRSVTGTPYWMSPEVIS
GEGYGRKADVWSLGCTVVEMLTEKPPWAEYEAMAAIFKIATQPTNPQLPSHISEHGRDFL
RRIFVEARQRPSAEELLTHHFAQLMY



')