Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4192

Name

MDK

Synonym

MK|NEGF2;midkine (neurite growth-promoting factor 2);MDK;midkine (neurite growth-promoting factor 2)

Definition

ARAP|amphiregulin-associated protein|midgestation and kidney protein|midkine|neurite outgrowth-promoting factor 2|neurite outgrowth-promoting protein

Position

11p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Glypican 2 network;PID Curated;200107

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Disease

Neurofibromatosis;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Brain ischemia;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

Stroke;FunDO

Disease

Endometriosis;FunDO

Disease

colorectal cancer;GAD

External Links

Links to Entrez Gene

4192

Links to all GeneRIF Items

4192

Links to iHOP

4192

Sequence Information

Nucleotide Sequence

>4192 : length: 432
atgcagcaccgaggcttcctcctcctcaccctcctcgccctgctggcgctcacctccgcg
gtcgccaaaaagaaagataaggtgaagaagggcggcccggggagcgagtgcgctgagtgg
gcctgggggccctgcacccccagcagcaaggattgcggcgtgggtttccgcgagggcacc
tgcggggcccagacccagcgcatccggtgcagggtgccctgcaactggaagaaggagttt
ggagccgactgcaagtacaagtttgagaactggggtgcgtgtgatgggggcacaggcacc
aaagtccgccaaggcaccctgaagaaggcgcgctacaatgctcagtgccaggagaccatc
cgcgtcaccaagccctgcacccccaagaccaaagcaaaggccaaagccaagaaagggaag
ggaaaggactag

Protein Sequence

>4192 : length: 143
MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGT
CGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETI
RVTKPCTPKTKAKAKAKKGKGKD



')