Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4092

Name

SMAD7

Synonym

CRCS3|MADH7|MADH8;SMAD family member 7;SMAD7;SMAD family member 7

Definition

MAD (mothers against decapentaplegic, Drosophila) homolog 7|MAD homolog 8|Mothers against decapentaplegic, drosophila, homolog of, 7|SMAD, mothers against DPP homolog 7|hSMAD7|mothers against DPP homolog 8|mothers against decapentaplegic homolog 7

Position

18q21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Signaling events mediated by HDAC Class I;PID Curated;200070

Pathway

Signaling by BMP;Reactome;REACT:12034

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

BMP Signalling Pathway;BioCyc;PWY66-11

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Disease

Scleroderma;FunDO

Disease

Colorectal cancer;NHGRI

Disease

Diabetes mellitus;FunDO

Disease

Chronic fatigue syndrome;FunDO

Disease

Systemic scleroderma;FunDO

Disease

CANCER;GAD

Disease

Cancer;FunDO

Disease

Colorectal cancer, susceptibility to, 3;OMIM

Disease

Helicobacter infection;FunDO

Disease

colorectal cancer;GAD

External Links

Links to Entrez Gene

4092

Links to all GeneRIF Items

4092

Links to iHOP

4092

Sequence Information

Nucleotide Sequence

>4092 : length: 1278
atgttcaggaccaaacgatctgcgctcgtccggcgtctctggaggagccgtgcgcccggc
ggcgaggacgaggaggagggcgcagggggaggtggaggaggaggcgagctgcggggagaa
ggggcgacggacagccgagcgcatggggccggtggcggcggcccgggcagggctggatgc
tgcctgggcaaggcggtgcgaggtgccaaaggtcaccaccatccccacccgccagccgcg
ggcgccggcgcggccgggggcgccgaggcggatctgaaggcgctcacgcactcggtgctc
aagaaactgaaggagcggcagctggagctgctgctccaggccgtggagtcccgcggcggg
acgcgcaccgcgtgcctcctgctgcccggccgcctggactgcaggctgggcccgggggcg
cccgccggcgcgcagcctgcgcagccgccctcgtcctactcgctccccctcctgctgtgc
aaagtgttcaggtggccggatctcaggcattcctcggaagtcaagaggctgtgttgctgt
gaatcttacgggaagatcaaccccgagctggtgtgctgcaacccccatcaccttagccga
ctctgcgaactagagtctcccccccctccttactccagatacccgatggattttctcaaa
ccaactgactgtccagatgctgtgccttcctccgctgaaacagggggaacgaattatctg
gcccctggggggctttcagattcccaacttcttctggagcctggggatcggtcacactgg
tgcgtggtggcatactgggaggagaagacgagagtggggaggctctactgtgtccaggag
ccctctctggatatcttctatgatctacctcaggggaatggcttttgcctcggacagctc
aattcggacaacaagagtcagctggtgcagaaggtgcggagcaaaatcggctgcggcatc
cagctgacgcgggaggtggatggtgtgtgggtgtacaaccgcagcagttaccccatcttc
atcaagtccgccacactggacaacccggactccaggacgctgttggtacacaaggtgttc
cccggtttctccatcaaggctttcgactacgagaaggcgtacagcctgcagcggcccaat
gaccacgagtttatgcagcagccgtggacgggctttaccgtgcagatcagctttgtgaag
ggctggggccagtgctacacccgccagttcatcagcagctgcccgtgctggctagaggtc
atcttcaacagccggtag

Protein Sequence

>4092 : length: 425
MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGC
CLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGG
TRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCC
ESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTDCPDAVPSSAETGGTNYL
APGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQL
NSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVF
PGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEV
IFNSR



')