Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4089

Name

SMAD4

Synonym

DPC4|JIP|MADH4;SMAD family member 4;SMAD4;SMAD family member 4

Definition

MAD homolog 4|SMAD, mothers against DPP homolog 4|deleted in pancreatic carcinoma locus 4|deletion target in pancreatic carcinoma 4|mothers against decapentaplegic homolog 4|mothers against decapentaplegic, Drosophila, homolog of, 4

Position

18q21.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling by BMP;PID Reactome;500592

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

alk in cardiac myocytes;PID BioCarta;100244

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

ALK1 signaling events;PID Curated;200126

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

BMP receptor signaling;PID Curated;200123

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

BMP Signalling Pathway;BioCyc;PWY66-11

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

ctcf: first multivalent nuclear factor;PID BioCarta;100194

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Signaling by BMP;Reactome;REACT:12034

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Signaling by TGF beta;PID Reactome;500590

Pathway

ALK2 signaling events;PID Curated;200138

Pathway

Regulation of cytoplasmic and nuclear SMAD2/3 signaling;PID Curated;200152

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Disease

Colorectal cancer;KEGG DISEASE;H00020

Disease

Capillaries disease;FunDO

Disease

Cancers;KEGG DISEASE

Disease

polyposis, gastric;GAD

Disease

Pancreatic cancer;KEGG DISEASE;H00019

Disease

Juvenile polyposis/hereditary hemorrhagic telangiectasia syndrome;OMIM

Disease

Pancreatic cancer;OMIM

Disease

polyposis, juvenile;GAD

Disease

Cancer;FunDO

Disease

Cancers of the digestive system;KEGG DISEASE

Disease

juvenile polyposis syndrome;GAD

Disease

Polyposis, juvenile intestinal;OMIM

Disease

Vascular disease;FunDO

External Links

Links to Entrez Gene

4089

Links to all GeneRIF Items

4089

Links to iHOP

4089

Sequence Information

Nucleotide Sequence

>4089 : length: 1659
atggacaatatgtctattacgaatacaccaacaagtaatgatgcctgtctgagcattgtg
catagtttgatgtgccatagacaaggtggagagagtgaaacatttgcaaaaagagcaatt
gaaagtttggtaaagaagctgaaggagaaaaaagatgaattggattctttaataacagct
ataactacaaatggagctcatcctagtaaatgtgttaccatacagagaacattggatggg
aggcttcaggtggctggtcggaaaggatttcctcatgtgatctatgcccgtctctggagg
tggcctgatcttcacaaaaatgaactaaaacatgttaaatattgtcagtatgcgtttgac
ttaaaatgtgatagtgtctgtgtgaatccatatcactacgaacgagttgtatcacctgga
attgatctctcaggattaacactgcagagtaatgctccatcaagtatgatggtgaaggat
gaatatgtgcatgactttgagggacagccatcgttgtccactgaaggacattcaattcaa
accatccagcatccaccaagtaatcgtgcatcgacagagacatacagcaccccagctctg
ttagccccatctgagtctaatgctaccagcactgccaactttcccaacattcctgtggct
tccacaagtcagcctgccagtatactggggggcagccatagtgaaggactgttgcagata
gcatcagggcctcagccaggacagcagcagaatggatttactggtcagccagctacttac
catcataacagcactaccacctggactggaagtaggactgcaccatacacacctaatttg
cctcaccaccaaaacggccatcttcagcaccacccgcctatgccgccccatcccggacat
tactggcctgttcacaatgagcttgcattccagcctcccatttccaatcatcctgctcct
gagtattggtgttccattgcttactttgaaatggatgttcaggtaggagagacatttaag
gttccttcaagctgccctattgttactgttgatggatacgtggacccttctggaggagat
cgcttttgtttgggtcaactctccaatgtccacaggacagaagccattgagagagcaagg
ttgcacataggcaaaggtgtgcagttggaatgtaaaggtgaaggtgatgtttgggtcagg
tgccttagtgaccacgcggtctttgtacagagttactacttagacagagaagctgggcgt
gcacctggagatgctgttcataagatctacccaagtgcatatataaaggtctttgatttg
cgtcagtgtcatcgacagatgcagcagcaggcggctactgcacaagctgcagcagctgcc
caggcagcagccgtggcaggaaacatccctggcccaggatcagtaggtggaatagctcca
gctatcagtctgtcagctgctgctggaattggtgttgatgaccttcgtcgcttatgcata
ctcaggatgagttttgtgaaaggctggggaccggattacccaagacagagcatcaaagaa
acaccttgctggattgaaattcacttacaccgggccctccagctcctagacgaagtactt
cataccatgccgattgcagacccacaacctttagactga

Protein Sequence

>4089 : length: 552
MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEKKDELDSLITA
ITTNGAHPSKCVTIQRTLDGRLQVAGRKGFPHVIYARLWRWPDLHKNELKHVKYCQYAFD
LKCDSVCVNPYHYERVVSPGIDLSGLTLQSNAPSSMMVKDEYVHDFEGQPSLSTEGHSIQ
TIQHPPSNRASTETYSTPALLAPSESNATSTANFPNIPVASTSQPASILGGSHSEGLLQI
ASGPQPGQQQNGFTGQPATYHHNSTTTWTGSRTAPYTPNLPHHQNGHLQHHPPMPPHPGH
YWPVHNELAFQPPISNHPAPEYWCSIAYFEMDVQVGETFKVPSSCPIVTVDGYVDPSGGD
RFCLGQLSNVHRTEAIERARLHIGKGVQLECKGEGDVWVRCLSDHAVFVQSYYLDREAGR
APGDAVHKIYPSAYIKVFDLRQCHRQMQQQAATAQAAAAAQAAAVAGNIPGPGSVGGIAP
AISLSAAAGIGVDDLRRLCILRMSFVKGWGPDYPRQSIKETPCWIEIHLHRALQLLDEVL
HTMPIADPQPLD



')