Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4088

Name

SMAD3

Synonym

HSPC193|HsT17436|JV15-2|LDS1C|MADH3;SMAD family member 3;SMAD3;SMAD family member 3

Definition

MAD homolog 3|MAD, mothers against decapentaplegic homolog 3|SMA- and MAD-related protein 3|SMAD, mothers against DPP homolog 3|hMAD-3|hSMAD3|mad homolog JV15-2|mad protein homolog|mad3|mothers against DPP homolog 3|mothers against decapentaplegic homolog

Position

15q22.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

Regulation of cytoplasmic and nuclear SMAD2/3 signaling;PID Curated;200152

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Chronic myeloid leukemia;KEGG PATHWAY;hsa05220

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

TGF-beta receptor signaling;PID Curated;200195

Pathway

cell cycle: g1/s check point;PID BioCarta;100160

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

TGF-beta signaling pathway;PANTHER;P00052

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

tgf beta signaling pathway;PID BioCarta;100017

Pathway

Cell cycle;KEGG PATHWAY;hsa04110

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Signaling by TGF beta;Reactome;REACT:6844

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Colorectal cancer;KEGG PATHWAY;hsa05210

Pathway

Pancreatic cancer;KEGG PATHWAY;hsa05212

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

Herpes;FunDO

Disease

Embryoma;FunDO

Disease

Dermatitis;FunDO

Disease

Adenoma;FunDO

Disease

Prostate cancer;FunDO

Disease

Bacteremia;GAD

Disease

Systemic scleroderma;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Scleroderma;FunDO

Disease

Coronary heart disease;NHGRI

Disease

Coronary Disease;GAD

Disease

Rabies;FunDO

Disease

Polyarthritis;FunDO

Disease

Asthma;NHGRI

Disease

Eating disorder;FunDO

Disease

INFECTION;GAD

Disease

Stomach cancer;FunDO

External Links

Links to Entrez Gene

4088

Links to all GeneRIF Items

4088

Links to iHOP

4088

Sequence Information

Nucleotide Sequence

>4088 : length: 963
atggagctgtgtgagttcgccttcaatatgaagaaggacgaggtctgcgtgaatccctac
cactaccagagagtagagacaccagttctacctcctgtgttggtgccacgccacacagag
atcccggccgagttccccccactggacgactacagccattccatccccgaaaacactaac
ttccccgcaggcatcgagccccagagcaatattccagagaccccaccccctggctacctg
agtgaagatggagaaaccagtgaccaccagatgaaccacagcatggacgcaggttctcca
aacctatccccgaatccgatgtccccagcacataataacttggacctgcagccagttacc
tactgcgagccggccttctggtgctccatctcctactacgagctgaaccagcgcgtcggg
gagacattccacgcctcgcagccatccatgactgtggatggcttcaccgacccctccaat
tcggagcgcttctgcctagggctgctctccaatgtcaacaggaatgcagcagtggagctg
acacggagacacatcggaagaggcgtgcggctctactacatcggaggggaggtcttcgca
gagtgcctcagtgacagcgctatttttgtccagtctcccaactgtaaccagcgctatggc
tggcacccggccaccgtctgcaagatcccaccaggatgcaacctgaagatcttcaacaac
caggagttcgctgccctcctggcccagtcggtcaaccagggctttgaggctgtctaccag
ttgacccgaatgtgcaccatccgcatgagcttcgtcaaaggctggggagcggagtacagg
agacagactgtgaccagtaccccctgctggattgagctgcacctgaatgggcctttgcag
tggcttgacaaggtcctcacccagatgggctccccaagcatccgctgttccagtgtgtct
tag

Protein Sequence

>4088 : length: 320
MELCEFAFNMKKDEVCVNPYHYQRVETPVLPPVLVPRHTEIPAEFPPLDDYSHSIPENTN
FPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVT
YCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNVNRNAAVEL
TRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNN
QEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQ
WLDKVLTQMGSPSIRCSSVS



')