Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4072

Name

EPCAM

Synonym

DIAR5|EGP-2|EGP314|EGP40|ESA|HNPCC8|KS1/4|KSA|M4S1|MIC18|MK-1|TACSTD1|TROP1;epithelial cell adhesion molecule;EPCAM;epithelial cell adhesion molecule

Definition

adenocarcinoma-associated antigen|cell surface glycoprotein Trop-1|epithelial glycoprotein 314|human epithelial glycoprotein-2|major gastrointestinal tumor-associated protein GA733-2|membrane component, chromosome 4, surface marker (35kD glycoprotein)|tum

Position

2p21

Gene Type

protein-coding

External Links

Links to Entrez Gene

4072

Links to all GeneRIF Items

4072

Links to iHOP

4072

Sequence Information

Nucleotide Sequence

>4072 : length: 945
atggcgcccccgcaggtcctcgcgttcgggcttctgcttgccgcggcgacggcgactttt
gccgcagctcaggaagaatgtgtctgtgaaaactacaagctggccgtaaactgctttgtg
aataataatcgtcaatgccagtgtacttcagttggtgcacaaaatactgtcatttgctca
aagctggctgccaaatgtttggtgatgaaggcagaaatgaatggctcaaaacttgggaga
agagcaaaacctgaaggggccctccagaacaatgatgggctttatgatcctgactgcgat
gagagcgggctctttaaggccaagcagtgcaacggcacctccatgtgctggtgtgtgaac
actgctggggtcagaagaacagacaaggacactgaaataacctgctctgagcgagtgaga
acctactggatcatcattgaactaaaacacaaagcaagagaaaaaccttatgatagtaaa
agtttgcggactgcacttcagaaggagatcacaacgcgttatcaactggatccaaaattt
atcacgagtattttgtatgagaataatgttatcactattgatctggttcaaaattcttct
caaaaaactcagaatgatgtggacatagctgatgtggcttattattttgaaaaagatgtt
aaaggtgaatccttgtttcattctaagaaaatggacctgacagtaaatggggaacaactg
gatctggatcctggtcaaactttaatttattatgttgatgaaaaagcacctgaattctca
atgcagggtctaaaagctggtgttattgctgttattgtggttgtggtgatagcagttgtt
gctggaattgttgtgctggttatttccagaaagaagagaatggcaaagtatgagaaggct
gagataaaggagatgggtgagatgcatagggaactcaatgcataa

Protein Sequence

>4072 : length: 314
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN
TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF
ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL
DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
EIKEMGEMHRELNA



')