Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4040

Name

LRP6

Synonym

ADCAD2;low density lipoprotein receptor-related protein 6;LRP6;low density lipoprotein receptor-related protein 6

Definition

LRP-6|low-density lipoprotein receptor-related protein 6

Position

12p13.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Presenilin action in Notch and Wnt signaling;PID Curated;200052

Pathway

Wnt signaling pathway;KEGG PATHWAY;hsa04310

Pathway

inactivation of gsk3 by akt causes accumulation of b-catenin in alveolar macrophages;PID BioCarta;100152

Pathway

Canonical Wnt signaling pathway;PID Curated;200064

Pathway

multi-step regulation of transcription by pitx2;PID BioCarta;100074

Pathway

Alzheimer disease-presenilin pathway;PANTHER;P00004

Pathway

Wnt signaling pathway;PANTHER;P00057

Pathway

wnt lrp6 signalling;PID BioCarta;100003

Pathway

wnt signaling pathway;PID BioCarta;100002

Pathway

Wnt signaling network;PID Curated;200055

Pathway

segmentation clock;PID BioCarta;100146

Disease

Thrombophlebitis;FunDO

Disease

Coronary Artery Disease;GAD

Disease

Dyslipidemias;GAD

Disease

Macular degeneration;FunDO

Disease

CARDIOVASCULAR;GAD

Disease

Rabies;FunDO

Disease

Coronary artery disease, autosomal dominant, 2;OMIM

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

4040

Links to all GeneRIF Items

4040

Links to iHOP

4040

Sequence Information

Nucleotide Sequence

>4040 : length: 4842
atgggggccgtcctgaggagcctcctggcctgcagcttctgtgtgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
agtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagaattt
aacaaaactgagagtgtgcagaatgttgttgtttctggattattgtcccccgatgggctg
gcatgtgattggcttggagaaaaattgtactggacagattctgaaactaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagtg
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacagtgaa
atttactggccaaatggactgactttggattatgaagaacaaaagctttattgggcagat
gcaaaacttaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacgttatttgaggacatattgtactggact
gactggagcacacactccattttggcttgcaacaagtatactggtgagggtctgcgtgaa
atccattctgacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgccacaaatccatgtggaattgacaatgggggttgttcccatttgtgtttgatgtct
ccagtcaagcctttttatcagtgtgcttgccccactggggtcaaactcctggagaatgga
aaaacctgcaaagatggtgccacagaattattgcttttagctcgaaggacagacttgaga
cgcatttctttggatacaccagattttacagacattgttctgcagttagaagacatccgt
catgccattgccatagattacgatcctgtggaaggctacatctactggactgatgatgaa
gtgagggccatacgccgttcatttatagatggatctggcagtcagtttgtggtcactgct
caaattgcccatcctgatggtattgctgtggactgggttgcacgaaatctttattggaca
gacactggcactgatcgaatagaagtgacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaattccgaaaattgagcgagcagctctggatggttctgac
cgtgtagtattggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaagattgaggttatgaatactgat
ggcactgggagacgagtactagtggaagacaaaattcctcacatatttggatttactttg
ttgggtgactatgtttactggactgactggcagaggcgtagcattgaaagagttcataaa
cgaagtgcagagagggaagtgatcatagatcagctgcctgacctcatgggcctaaaggct
acaaatgttcatcgagtgattggttccaacccctgtgctgaggaaaacgggggatgtagc
catctctgcctctatagacctcagggccttcgctgtgcttgccctattggctttgaactc
atcagtgacatgaagacctgcattgtcccagaggctttccttttgttttcacggagagca
gatatcagacgaatttctctggaaacaaacaataataatgtggctattccactcactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatttattggactgat
atatcactcaagaccatcagcagagcctttatgaatggcagtgcactggaacatgtggta
gaattcggcttagattatccagaaggcatggcagtagactggcttgggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtgtggaaagacctagatagtcccagagctctcgcgttggaccctgccgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgcaatggatgga
agtgaacgtactaccttagttccaaatgtggggcgggcaaacggcctaactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttgggctcaaccgtgaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattatatctactggacggactggagccgacgcagcattgagcgtgccaacaaa
accagtggccaaaaccgcaccatcattcagggccatttggattatgtgatggacatcctc
gtctttcactcatctcgacagtcagggtggaatgaatgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaatgctgacaacaggacttgtagtgctcctacgactttcctgctcttcagtcaa
aagagtgccatcaaccgcatggtgattgatgaacaacagagccccgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaggcacaagaagatggcagccagggcttt
actgtggttgtgagctcagttccgagtcagaacctggaaatacaaccctatgacctcagc
attgatatttacagccgctacatctactggacttgtgaggctaccaatgtcattaatgtg
acaagattagatgggagatcagttggagtggtgctgaaaggcgagcaggacagacctcga
gccgttgtggtaaacccagagaaagggtatatgtattttaccaatcttcaggaaaggtct
cctaaaattgaacgggctgctttggatgggacagaacgggaggtcctctttttcagtggc
ttaagtaaaccaattgctttagcccttgatagcaggctgggcaagctcttttgggctgat
tcagatctccggcgaattgaaagcagtgatctctcaggtgctaaccggatagtattagaa
gactccaatatcttgcagcctgtgggacttactgtgtttgaaaactggctctattggatt
gataaacagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaaccaaa
gtccaagctcgaattgcccagcttagtgacattcatgcagtaaaggagctgaaccttcaa
gaatacagacagcacccttgtgctcaggataatggtggctgttcacatatttgtcttgta
aagggggatggtactacaaggtgttcttgccccatgcacctggttctacttcaagatgag
ctatcatgtggagaacctccaacatgttctcctcagcagtttacttgtttcacgggggaa
attgactgtatccctgtggcttggcggtgcgatgggtttactgaatgtgaagaccacagt
gatgaactcaattgtcctgtatgctcagagtcccagttccagtgtgccagtgggcagtgt
attgatggtgccctccgatgcaatggagatgcaaactgccaggacaaatcagatgagaag
aactgtgaagtgctttgtttaattgatcagttccgctgtgccaatggtcagtgcattgga
aagcacaagaagtgtgatcataatgtggattgcagtgacaagtcagatgaactggattgt
tatccgactgaagaaccagcaccacaggccaccaatacagttggttctgttattggcgta
attgtcaccatttttgtgtctggaactgtatactttatctgccagaggatgttgtgtcca
cgtatgaagggagatggggaaactatgactaatgactatgtagttcatggaccagcttct
gtgcctcttggttatgtgccacacccaagttctttgtcaggatctcttccaggaatgtct
cgaggtaaatcaatgatcagctccctcagtatcatggggggaagcagtggacccccctat
gaccgagcccatgttacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccaccatccccagccacagagcgatcacattacactatg
gaatttggatattcttcaaacagtccttccactcataggtcatacagctacaggccatat
agctaccggcactttgcaccccccaccacaccctgcagcacagatgtttgtgacagtgac
tatgctcctagtcggagaatgacctcagtggcaacagccaagggctataccagtgacttg
aactatgattcagaacctgtgcccccacctcccacaccccgaagccaatacttgtcagca
gaggagaactatgaaagctgcccaccttctccatacacagagaggagctattctcatcac
ctctacccaccgccaccctctccctgtacagactcctcctga

Protein Sequence

>4040 : length: 1613
MGAVLRSLLACSFCVLLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
SHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINSE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDILYWT
DWSTHSILACNKYTGEGLREIHSDIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNTDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREVIIDQLPDLMGLKATNVHRVIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQSGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPSQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSVGVVLKGEQDRPRAVVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCANGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTVYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVATAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS



')