Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4017

Name

LOXL2

Synonym

LOR2|WS9-14;lysyl oxidase-like 2;LOXL2;lysyl oxidase-like 2

Definition

lysyl oxidase homolog 2|lysyl oxidase related 2|lysyl oxidase-like protein 2|lysyl oxidase-related protein 2|lysyl oxidase-related protein WS9-14

Position

8p21.3

Gene Type

protein-coding

External Links

Links to Entrez Gene

4017

Links to all GeneRIF Items

4017

Links to iHOP

4017

Sequence Information

Nucleotide Sequence

>4017 : length: 2325
atggagaggcctctgtgctcccacctctgcagctgcctggctatgctggccctcctgtcc
cccctgagcctggcacagtatgacagctggccccattaccccgagtacttccagcaaccg
gctcctgagtatcaccagccccaggcccccgccaacgtggccaagattcagctgcgcctg
gctgggcagaagaggaagcacagcgagggccgggtggaggtgtactatgatggccagtgg
ggcaccgtgtgcgatgacgacttctccatccacgctgcccacgtcgtctgccgggagctg
ggctacgtggaggccaagtcctggactgccagctcctcctacggcaagggagaagggccc
atctggttagacaatctccactgtactggcaacgaggcgacccttgcagcatgcacctcc
aatggctggggcgtcactgactgcaagcacacggaggatgtcggtgtggtgtgcagcgac
aaaaggattcctgggttcaaatttgacaattcgttgatcaaccagatagagaacctgaat
atccaggtggaggacattcggattcgagccatcctctcaacctaccgcaagcgcacccca
gtgatggagggctacgtggaggtgaaggagggcaagacctggaagcagatctgtgacaag
cactggacggccaagaattcccgcgtggtctgcggcatgtttggcttccctggggagagg
acatacaataccaaagtgtacaaaatgtttgcctcacggaggaagcagcgctactggcca
ttctccatggactgcaccggcacagaggcccacatctccagctgcaagctgggcccccag
gtgtcactggaccccatgaagaatgtcacctgcgagaatgggctaccggccgtggtgagt
tgtgtgcctgggcaggtcttcagccctgacggaccctcaagattccggaaagcgtacaag
ccagagcaacccctggtgcgactgagaggcggtgcctacatcggggagggccgcgtggag
gtgctcaaaaatggagaatgggggaccgtctgcgacgacaagtgggacctggtgtcggcc
agtgtggtctgcagagagctgggctttgggagtgccaaagaggcagtcactggctcccga
ctggggcaagggatcggacccatccacctcaacgagatccagtgcacaggcaatgagaag
tccattatagactgcaagttcaatgccgagtctcagggctgcaaccacgaggaggatgct
ggtgtgagatgcaacacccctgccatgggcttgcagaagaagctgcgcctgaacggcggc
cgcaatccctacgagggccgagtggaggtgctggtggagagaaacgggtcccttgtgtgg
gggatggtgtgtggccaaaactggggcatcgtggaggccatggtggtctgccgccagctg
ggcctgggattcgccagcaacgccttccaggagacctggtattggcacggagatgtcaac
agcaacaaagtggtcatgagtggagtgaagtgctcgggaacggagctgtccctggcgcac
tgccgccacgacggggaggacgtggcctgcccccagggcggagtgcagtacggggccgga
gttgcctgctcagaaaccgcccctgacctggtcctcaatgcggagatggtgcagcagacc
acctacctggaggaccggcccatgttcatgctgcagtgtgccatggaggagaactgcctc
tcggcctcagccgcgcagaccgaccccaccacgggctaccgccggctcctgcgcttctcc
tcccagatccacaacaatggccagtccgacttccggcccaagaacggccgccacgcgtgg
atctggcacgactgtcacaggcactaccacagcatggaggtgttcacccactatgacctg
ctgaacctcaatggcaccaaggtggcagagggccacaaggccagcttctgcttggaggac
acagaatgtgaaggagacatccagaagaattacgagtgtgccaacttcggcgatcagggc
atcaccatgggctgctgggacatgtaccgccatgacatcgactgccagtgggttgacatc
actgacgtgccccctggagactacctgttccaggttgttattaaccccaacttcgaggtt
gcagaatccgattactccaacaacatcatgaaatgcaggagccgctatgacggccaccgc
atctggatgtacaactgccacataggtggttccttcagcgaagagacggaaaaaaagttt
gagcacttcagcgggctcttaaacaaccagctgtccccgcagtaa

Protein Sequence

>4017 : length: 774
MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRL
AGQKRKHSEGRVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGP
IWLDNLHCTGNEATLAACTSNGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLN
IQVEDIRIRAILSTYRKRTPVMEGYVEVKEGKTWKQICDKHWTAKNSRVVCGMFGFPGER
TYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQVSLDPMKNVTCENGLPAVVS
CVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTVCDDKWDLVSA
SVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQL
GLGFASNAFQETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAG
VACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFS
SQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHKASFCLED
TECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDITDVPPGDYLFQVVINPNFEV
AESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQLSPQ



')