Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

4015

Name

LOX

Synonym

-;lysyl oxidase;LOX;lysyl oxidase

Definition

protein-lysine 6-oxidase

Position

5q23.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

4015

Links to all GeneRIF Items

4015

Links to iHOP

4015

Sequence Information

Nucleotide Sequence

>4015 : length: 564
atgtccatgtacaacctgagatgcgcggcggaggaaaactgtctggccagtacagcatac
agggcagatgtcagagattatgatcacagggtgctgctcagatttccccaaagagtgaaa
aaccaagggacatcagatttcttacccagccgaccaagatattcctgggaatggcacagt
tgtcatcaacattaccacagtatggatgagtttagccactatgacctgcttgatgccaac
acccagaggagagtggctgaaggccacaaagcaagtttctgtcttgaagacacatcctgt
gactatggctaccacaggcgatttgcatgtactgcacacacacagggattgagtcctggc
tgttatgatacctatggtgcagacatagactgccagtggattgatattacagatgtaaaa
cctggaaactatatcctaaaggtcagtgtaaaccccagctacctggttcctgaatctgac
tataccaacaatgttgtgcgctgtgacattcgctacacaggacatcatgcgtatgcctca
ggctgcacaatttcaccgtattag

Protein Sequence

>4015 : length: 187
MSMYNLRCAAEENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHS
CHQHYHSMDEFSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPG
CYDTYGADIDCQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYAS
GCTISPY



')