Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3987

Name

LIMS1

Synonym

PINCH|PINCH-1|PINCH1;LIM and senescent cell antigen-like domains 1;LIMS1;LIM and senescent cell antigen-like domains 1

Definition

LIM and senescent cell antigen-like-containing domain protein 1|particularly interesting new Cys-His protein 1|renal carcinoma antigen NY-REN-48

Position

2q12.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Regulation of cytoskeletal remodeling and cell spreading by IPP complex components;PID Reactome;500125

Pathway

Cell junction organization;Reactome;REACT:20676

Disease

Brain tumor;FunDO

Disease

Kidney disease;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to Entrez Gene

3987

Links to all GeneRIF Items

3987

Links to iHOP

3987

Sequence Information

Nucleotide Sequence

>3987 : length: 990
atgacatgcaacatggccaacgccctggccagcgccacttgcgagcgctgcaagggcggc
tttgcgcccgctgagaagatcgtgaacagtaatggggagctgtaccatgagcagtgtttc
gtgtgcgctcagtgcttccagcagttcccagaaggactcttctatgagtttgaaggaaga
aagtactgtgaacatgactttcagatgctctttgccccttgctgtcatcagtgtggtgaa
ttcatcattggccgagttatcaaagccatgaataacagctggcatccggagtgcttccgc
tgtgacctctgccaggaagttctggcagatatcgggtttgtcaagaatgctgggagacac
ctgtgtcgcccctgtcataatcgtgagaaagccagaggccttgggaaatacatctgccag
aaatgccatgctatcatcgatgagcagcctctgatattcaagaacgacccctaccatcca
gaccatttcaactgcgccaactgcgggaaggagctgactgccgatgcacgggagctgaaa
ggggagctatactgcctcccatgccatgataaaatgggggtccccatctgtggtgcttgc
cgacggcccatcgaagggcgcgtggtgaacgctatgggcaagcagtggcatgtggagcat
tttgtttgtgccaagtgtgagaaaccctttcttggacatcgccattatgagaggaaaggc
ctggcatattgtgaaactcactataaccagctatttggtgatgtttgcttccactgcaat
cgtgttatagaaggtgatgtggtctctgctcttaataaggcctggtgcgtgaactgcttt
gcctgttctacctgcaacactaaattaacactcaagaataagtttgtggagtttgacatg
aagccagtctgtaagaagtgctatgagaaatttccattggagctgaagaaaagacttaag
aaactagctgagaccttaggaaggaaataa

Protein Sequence

>3987 : length: 329
MTCNMANALASATCERCKGGFAPAEKIVNSNGELYHEQCFVCAQCFQQFPEGLFYEFEGR
KYCEHDFQMLFAPCCHQCGEFIIGRVIKAMNNSWHPECFRCDLCQEVLADIGFVKNAGRH
LCRPCHNREKARGLGKYICQKCHAIIDEQPLIFKNDPYHPDHFNCANCGKELTADARELK
GELYCLPCHDKMGVPICGACRRPIEGRVVNAMGKQWHVEHFVCAKCEKPFLGHRHYERKG
LAYCETHYNQLFGDVCFHCNRVIEGDVVSALNKAWCVNCFACSTCNTKLTLKNKFVEFDM
KPVCKKCYEKFPLELKKRLKKLAETLGRK



')