Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3952

Name

LEP

Synonym

OB|OBS;leptin;LEP;leptin

Definition

leptin (murine obesity homolog)|leptin (obesity homolog, mouse)|obese protein|obese, mouse, homolog of|obesity factor

Position

7q31.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

reversal of insulin resistance by leptin;PID BioCarta;100117

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Neuroactive ligand-receptor interaction;KEGG PATHWAY;hsa04080

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Synthesis, Secretion, and Deacylation of Ghrelin;PID Reactome;500141

Disease

Rett syndrome;FunDO

Disease

Neuroblastoma;FunDO

Disease

Lipodystrophy;FunDO

Disease

Obesity, severe, due to leptin deficiency;OMIM

Disease

depression;GAD

Disease

Obesity, morbid, with hypogonadism;OMIM

Disease

Purpura, Thrombocytopenic, Idiopathic;FunDO

Disease

Lung cancer;FunDO

Disease

leptin expression;GAD

Disease

Asthma;FunDO

Disease

insulin;GAD

Disease

Polyarthritis;FunDO

Disease

obesity;GAD

Disease

Cholelithiasis;FunDO

Disease

AGING;GAD

Disease

Eating disorder;FunDO

Disease

Down syndrome;FunDO

Disease

HIV infection;FunDO

Disease

Sickle cell disease;FunDO

Disease

Helicobacter infection;FunDO

Disease

Embryoma;FunDO

Disease

Stomach cancer;FunDO

Disease

hypertension;GAD

Disease

Cirrhosis;FunDO

Disease

Prostate cancer;FunDO

Disease

lung cancer;GAD

Disease

Anemia;FunDO

Disease

Huntington disease;FunDO

Disease

body mass leptin obesity;GAD

Disease

Leukemia;FunDO

Disease

PHARMACOGENOMIC;GAD

Disease

Dental plaque;FunDO

Disease

Schizophrenia;FunDO

Disease

heart disease risk factors hypertension leptin obesity;GAD

Disease

Kidney disease;FunDO

Disease

Colon cancer;FunDO

Disease

Intermediate coronary syndrome;FunDO

Disease

leptin;GAD

Disease

METABOLIC;GAD

Disease

Primary biliary cirrhosis;FunDO

Disease

age of menarche;GAD

Disease

diabetes, type 2;GAD

Disease

PSYCH;GAD

Disease

Aortic aneurysm;FunDO

Disease

Weight Gain;GAD

Disease

prostate cancer;GAD

Disease

Choriocarcinoma;FunDO

Disease

Fatty liver;FunDO

Disease

Hyperinsulinism;FunDO

Disease

Familial Mediterranean fever;FunDO

Disease

Hypothyroidism;FunDO

Disease

Pancreas disease;FunDO

Disease

Liver cancer;FunDO

Disease

BMI;GAD

Disease

Narcolepsy;FunDO

Disease

Autistic disorder;FunDO

Disease

Female reproductive system disorder;FunDO

Disease

Multiple sclerosis;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Breast cancer;FunDO

Disease

Growth retardation;FunDO

Disease

Behcet syndrome;FunDO

Disease

fat mass;GAD

Disease

CARDIOVASCULAR;GAD

Disease

body mass;GAD

Disease

Overweight;GAD

Disease

Osteoporosis;FunDO

Disease

Ankylosing spondylitis;FunDO

Disease

CANCER;GAD

Disease

schizophrenia;GAD

Disease

Transient hypertension of pregnancy;FunDO

Disease

Obesity;FunDO

Disease

Anorexia nervosa;FunDO

Disease

Infertility;FunDO

Disease

Advanced cancer;FunDO

Disease

Protein-energy malnutrition;FunDO

Disease

body fat;GAD

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3952

Links to all GeneRIF Items

3952

Links to iHOP

3952

Sequence Information

Nucleotide Sequence

>3952 : length: 504
atgcattggggaaccctgtgcggattcttgtggctttggccctatcttttctatgtccaa
gctgtgcccatccaaaaagtccaagatgacaccaaaaccctcatcaagacaattgtcacc
aggatcaatgacatttcacacacgcagtcagtctcctccaaacagaaagtcaccggtttg
gacttcattcctgggctccaccccatcctgaccttatccaagatggaccagacactggca
gtctaccaacagatcctcaccagtatgccttccagaaacgtgatccaaatatccaacgac
ctggagaacctccgggatcttcttcacgtgctggccttctctaagagctgccacttgccc
tgggccagtggcctggagaccttggacagcctggggggtgtcctggaagcttcaggctac
tccacagaggtggtggccctgagcaggctgcaggggtctctgcaggacatgctgtggcag
ctggacctcagccctgggtgctga

Protein Sequence

>3952 : length: 167
MHWGTLCGFLWLWPYLFYVQAVPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGL
DFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLP
WASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC



')