Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3934

Name

LCN2

Synonym

24p3|MSFI|NGAL;lipocalin 2;LCN2;lipocalin 2

Definition

25 kDa alpha-2-microglobulin-related subunit of MMP-9|lipocalin-2|migration-stimulating factor inhibitor|neutrophil gelatinase-associated lipocalin|oncogene 24p3|p25|siderocalin

Position

9q34

Gene Type

protein-coding

External Links

Links to Entrez Gene

3934

Links to all GeneRIF Items

3934

Links to iHOP

3934

Sequence Information

Nucleotide Sequence

>3934 : length: 597
atgcccctaggtctcctgtggctgggcctagccctgttgggggctctgcatgcccaggcc
caggactccacctcagacctgatcccagccccacctctgagcaaggtccctctgcagcag
aacttccaggacaaccaattccaggggaagtggtatgtggtaggcctggcagggaatgca
attctcagagaagacaaagacccgcaaaagatgtatgccaccatctatgagctgaaagaa
gacaagagctacaatgtcacctccgtcctgtttaggaaaaagaagtgtgactactggatc
aggacttttgttccaggttgccagcccggcgagttcacgctgggcaacattaagagttac
cctggattaacgagttacctcgtccgagtggtgagcaccaactacaaccagcatgctatg
gtgttcttcaagaaagtttctcaaaacagggagtacttcaagatcaccctctacgggaga
accaaggagctgacttcggaactaaaggagaacttcatccgcttctccaaatctctgggc
ctccctgaaaaccacatcgtcttccctgtcccaatcgaccagtgtatcgacggctga

Protein Sequence

>3934 : length: 198
MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNA
ILREDKDPQKMYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSY
PGLTSYLVRVVSTNYNQHAMVFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLG
LPENHIVFPVPIDQCIDG



')