Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3911

Name

LAMA5

Synonym

-;laminin, alpha 5;LAMA5;laminin, alpha 5

Definition

laminin alpha-5 chain|laminin subunit alpha-5|laminin-10 subunit alpha|laminin-11 subunit alpha|laminin-15 subunit alpha

Position

20q13.2-q13.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Syndecan-1-mediated signaling events;PID Curated;200134

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Disease

Prostate cancer;FunDO

Disease

Infection;FunDO

Disease

Asthma;FunDO

Disease

Leukemia;FunDO

Disease

Congenital abnormality;FunDO

Disease

Brain tumor;FunDO

Disease

Liver cancer;FunDO

External Links

Links to Entrez Gene

3911

Links to all GeneRIF Items

3911

Links to iHOP

3911

Sequence Information

Nucleotide Sequence

>3911 : length: 11088
atggcgaagcggctctgcgcggggagcgcactgtgtgttcgcggcccccggggccccgcg
ccgctgctgctggtcgggctggcgctgctgggcgcggcgcgggcgcgggaggaggcgggc
ggcggcttcagcctgcacccgccctacttcaacctggccgagggcgcccgcatcgccgcc
tccgcgacctgcggagaggaggccccggcgcgcggctccccgcgccccaccgaggacctt
tactgcaagctggtagggggccccgtggccggcggcgaccccaaccagaccatccggggc
cagtactgtgacatctgcacggctgccaacagcaacaaggcacaccccgcgagcaatgcc
atcgatggcacggagcgctggtggcagagtccaccgctgtcccgcggcctggagtacaac
gaggtcaacgtcaccctggacctgggccaggtcttccacgtggcctacgtcctcatcaag
tttgccaactcaccccggccggacctctgggtgctggagcggtccatggacttcggccgc
acctaccagccctggcagttctttgcctcctccaagagggactgtctggagcggttcggg
ccacagacgctggagcgcatcacacgggacgacgcggccatctgcaccaccgagtactca
cgcatcgtgcccctggagaacggagagatcgtggtgtccctggtgaacggacgtccgggc
gccatgaatttctcctactcgccgctgctacgtgagttcaccaaggccaccaacgtccgc
ctgcgcttcctgcgtaccaacacgctgctgggccatctcatggggaaggcgctgcgggac
cccacggtcacccgccggtattattacagcatcaaggatatcagcatcggaggccgctgt
gtctgccacggccacgcggatgcctgcgatgccaaagaccccacggacccgttcaggctg
cagtgcacctgccagcacaacacctgcgggggcacctgcgaccgctgctgccccggcttc
aatcagcagccgtggaagcctgcgactgccaacagtgccaacgagtgccagtcctgtaac
tgctacggccatgccaccgactgttactacgaccctgaggtggaccggcgccgcgccagc
cagagcctggatggcacctatcagggtgggggtgtctgtatcgactgccagcaccacacc
accggcgtcaactgtgagcgctgcctgcccggcttctaccgctctcccaaccaccctctc
gactcgccccacgtctgccgccgctgcaactgcgagtccgacttcacggatggcacctgc
gaggacctgacgggtcgatgctactgccggcccaacttctctggggagcggtgtgacgtg
tgtgccgagggcttcacgggcttcccaagctgctacccgacgccctcgtcctccaatgac
accagggagcaggtgctgccagccggccagattgtgaattgtgactgcagcgcggcaggg
acccagggcaacgcctgccggaaggacccaagggtgggacgctgtctgtgcaaacccaac
ttccaaggcacccattgtgagctctgcgcgccagggttctacggccccggctgccagccc
tgccagtgttccagccctggagtggccgatgaccgctgtgaccctgacacaggccagtgc
aggtgccgagtgggcttcgagggggccacatgtgatcgctgtgcccccggctactttcac
ttccctctctgccagttgtgtggctgcagccctgcaggaaccttgcccgagggctgcgat
gaggccggccgctgcctatgccagcctgagtttgctggacctcattgtgaccggtgccgc
cctggctaccatggtttccccaactgccaagcatgcacctgcgaccctcggggagccctg
gaccagctctgtggggcgggaggtttgtgccgctgccgccccggctacacaggcactgcc
tgccaggaatgcagccccggctttcacggcttccccagctgtgtcccctgccactgctct
gctgaaggctccctgcacgcagcctgtgacccccggagtgggcagtgcagctgccggccc
cgtgtgacggggctgcggtgtgacacatgtgtgcccggtgcctacaacttcccctactgc
gaagctggctcttgccaccctgccggtctggccccagtggatcctgcccttcctgaggca
caggttccctgtatgtgccgggctcacgtggaggggccgagctgtgaccgctgcaaacct
gggttctggggactgagccccagcaaccccgagggctgtacccgctgcagctgcgacctc
aggggcacactgggtggagttgctgagtgccagccgggcaccggccagtgcttctgcaag
ccccacgtgtgcggccaggcctgcgcgtcctgcaaggatggcttctttggactggatcag
gctgactattttggctgccgcagctgccggtgtgacattggcggtgcactgggccagagc
tgtgaaccgaggacgggcgtctgccggtgccgccccaacacccagggccccacctgcagc
gagcctgcgagggaccactacctcccggacctgcaccacctgcgcctggagctggaggag
gctgccacacctgagggtcacgccgtgcgctttggcttcaaccccctcgagttcgagaac
ttcagctggaggggctacgcgcagatggcacctgtccagcccaggatcgtggccaggctg
aacctgacctcccctgaccttttctggctcgtcttccgatacgtcaaccggggggccatg
agtgtgagcgggcgggtctctgtgcgagaggagggcaggtcggccacctgcgccaactgc
acagcacagagtcagcccgtggccttcccacccagcacggagcctgccttcatcaccgtg
ccccagaggggcttcggagagccctttgtgctgaaccctggcacctgggccctgcgtgtg
gaggccgaaggggtgctcctggactacgtggttctgctgcctagcgcatactacgaggcg
gcgctcctgcagctgcgggtgactgaggcctgcacataccgtccctctgcccagcagtct
ggcgacaactgcctcctctacacacacctccccctggatggcttcccctcggccgccggg
ctggaggccctgtgtcgccaggacaacagcctgccccggccctgccccacggagcagctc
agcccgtcgcacccgccactgatcacctgcacgggcagtgatgtggacgtccagcttcaa
gtggcagtgccacagccaggccgctatgccctagtggtggagtacgccaatgaggatgcc
cgccaggaggtgggcgtggccgtgcacaccccacagcgggccccccagcaggggctgctc
tccctgcacccctgcctgtacagcaccctgtgccggggcactgcccgggatacccaggac
cacctggctgtcttccacctggactcggaggccagcgtgaggctcacagccgaacaggca
cgcttcttcctgcacggggtcactctggtgcccattgaggagttcagcccggagttcgtg
gagccccgggtcagctgcatcagcagccacggcgcctttggccccaacagtgccgcctgt
ctgccctcgcgcttcccaaagccgccccagcccatcatcctcagggactgccaggtgatc
ccgctgccgcccggcctcccgctgacccacgcgcaggatctcactccagccatgtcccca
gctggaccccgacctcggccccccaccgctgtggaccctgatgcagagcccaccctgctg
cgtgagccccaggccaccgtggtcttcaccacccatgtgcccacgctgggccgctatgcc
ttcctgctgcacggctaccagccagcccaccccaccttccccgtggaagtcctcatcaac
gccggccgcgtgtggcagggccacgccaacgccagcttctgtccacatggctacggctgc
cgcaccctggtggtgtgtgagggccaggccctgctggacgtgacccacagcgagctcact
gtgaccgtgcgtgtgcccaagggccggtggctctggctggattatgtactcgtggtccct
gagaacgtctacagctttggctacctccgggaggagcccctggataaatcctatgacttc
atcagccactgcgcagcccagggctaccacatcagccccagcagctcatccctgttctgc
cgaaacgctgctgcttccctctccctcttctataacaacggagcccgtccatgtggctgc
cacgaagtaggtgctacaggccccacgtgtgagcccttcgggggccagtgtccctgccat
gcccatgtcattggccgtgactgctcccgctgtgccaccggatactggggcttccccaac
tgcaggccctgtgactgcggtgcccgcctctgtgacgagctcacgggccagtgcatctgc
ccgccacgcaccatcccgcccgactgcctgctgtgccagccccagacctttggctgccac
cccctggtcggctgtgaggagtgtaactgctcagggcccggcatccaggagctcacagac
cctacctgtgacacagacagcggccagtgcaagtgcagacccaacgtgactgggcgccgc
tgtgatacctgctctccgggcttccatggctacccccgctgccgcccctgtgactgtcac
gaggcgggcactgcgcctggcgtgtgtgaccccctcacagggcagtgctactgtaaggag
aacgtgcagggccccaaatgtgaccagtgcagccttgggaccttctcactggatgctgcc
aaccccaaaggttgcacccgctgcttctgctttggggccacggagcgctgccggagctcg
tcctacacccgccaggagttcgtggatatggagggatgggtgctgctgagcactgaccgg
caggtggtgccccacgagcggcagccagggacggagatgctccgtgcagacctgcggcac
gtgcctgaggctgtgcccgaggctttccccgagctgtactggcaggccccaccctcctac
ctgggggaccgggtgtcatcctacggtgggaccctccgttatgaactgcactcagagacc
cagcggggagatgtctttgtccccatggagagcaggccggatgtggtgctgcagggcaac
cagatgagcatcacattcctggagccggcataccccacgcctggccacgttcaccgtggg
cagctgcagctggtggaggggaacttccggcatacggagacgcgcaacactgtgtcccgc
gaggagctcatgatggtgctggccagcctggagcagctgcagatccgtgccctcttctca
cagatctcctcggctgtcttcctgcgcagggtggcactggaggtggccagcccagcaggc
cagggggccctggccagcaatgtggagctgtgcctgtgccccgccagctaccggggggac
tcatgccaggaatgtgcccccggcttctatcgggacgtcaaaggtctcttcctgggccga
tgtgtcccttgtcagtgccatggacactcagaccgctgcctccctggctctggcgtctgt
gtggactgccagcacaacaccgaaggggcccactgtgagcgctgccaggctggcttcgtg
agcagcagggacgaccccagcgccccctgtgtcagctgcccctgccccctctcagtgcct
tccaacaacttcgccgagggctgtgtcctgcgaggcggccgcacccagtgcctctgcaaa
cctggttatgcaggtgcctcctgcgagcggtgtgcgcccggattctttgggaacccactg
gtgctgggcagctcctgccagccatgcgactgcagcggcaacggtgaccccaacttgctc
ttcagcgactgcgaccccctgacgggcgcctgccgtggctgcctgcgccacaccactggg
ccccgctgcgagatctgtgcccccggcttctacggcaacgccctgctgcccggcaactgc
acccggtgcgactgtaccccatgtgggacagaggcctgcgacccccacagcgggcactgc
ctgtgcaaggcgggcgtgactgggcggcgctgtgaccgctgccaggagggacattttggt
ttcgatggctgcgggggctgccgcccgtgtgcttgtggaccggccgccgagggctccgag
tgccacccccagagcggacagtgccactgccgaccagggaccatgggaccccagtgccgc
gagtgtgcccctggctactgggggctccctgagcagggctgcaggcgctgccagtgccct
gggggccgctgtgaccctcacacgggccgctgcaactgccccccggggctcagcggggag
cgctgcgacacctgcagccagcagcatcaggtgcctgttccaggcgggcctgtgggccac
agcatccactgtgaagtgtgtgaccactgtgtggtcctgctcctggatgacctggaacgg
gccggcgccctcctccccgccattcacgagcaactgcgtggcatcaatgccagctccatg
gcctgggcccgtctgcacaggctgaacgcctccatcgctgacctgcagagccagctccgg
agccccctgggcccccgccatgagacggcacagcagctggaggtgctggagcagcagagc
acaagcctcgggcaggacgcacggcggctaggcggccaggccgtggggacccgagaccag
gcgagccaattgctggccggcaccgaggccacactgggccatgcgaagacgctgttggcg
gccatccgggctgtggaccgcaccctgagcgagctcatgtcccagacgggccacctgggg
ctggccaatgcctcggctccatcaggtgagcagctgctccggacactggccgaggtggag
cggctgctctgggagatgcgggcccgggacctgggggccccgcaggcagcagctgaggct
gagttggctgcagcacagagattgctggcccgggtgcaggagcagctgagcagcctctgg
gaggagaaccaggcactggccacacaaacccgcgaccggctggcccagcacgaggccggc
ctcatggacctgcgagaggctttgaaccgggcagtggacgccacacgggaggcccaggag
ctcaacagccgcaaccaggagcgcctggaggaagccctgcaaaggaagcaggagctgtcc
cgggacaatgccaccctgcaggccactctgcatgcggctagggacaccctggccagcgtc
ttcagattgctgcacagcctggaccaggctaaggaggagctggagcgcctcgccgccagc
ctggatggggctcggaccccactgctgcagaggatgcagaccttctccccggcgggcagc
aagctgcgtctagtggaggccgccgaggcccacgcacagcagctgggccagctggcactc
aatctgtccagcatcatcctggacgtcaaccaggaccgcctcacccagagggccatcgag
gcctccaacgcctacagccgcatcctgcaggccgtgcaggctgccgaggatgctgctggc
caggccctgcagcaggcggaccacacgtgggcgacggtggtgcggcagggcctggtggac
cgagcccagcagctcctggccaacagcactgcactagaagaggccatgctccaggaacag
cagaggctgggccttgtgtgggctgccctccagggtgccaggacccagctccgagatgtc
cgggccaagaaggaccagctggaggcgcacatccaggcggcgcaggccatgcttgccatg
gacacagacgagacaagcaagaagatcgcacatgccaaggctgtggctgctgaagcccag
gacaccgccacccgtgtgcagtcccagctgcaggccatgcaggagaatgtggagcggtgg
cagggccagtacgagggcctgcggggccaggacctgggccaggcagtgcttgacgcaggc
cactcagtgtccaccctggagaagacgctgccccagctgctggccaagctgagcatcctg
gagaaccgtggggtgcacaacgccagcctggccctgtccgccagcattggccgcgtgcga
gagctcattgcccaggcccggggggctgccagtaaggtcaaggtgcccatgaagttcaac
gggcgctcaggggtgcagctgcgcaccccacgggatcttgccgaccttgctgcctacact
gccctcaagttctacctgcagggcccagagcctgagcctgggcagggtaccgaggatcgc
tttgtgatgtacatgggcagccgccaggccactggggactacatgggtgtgtctctgcgt
gacaagaaggtgcactgggtgtatcagctgggtgaggcgggccctgcagtcctaagcatc
gatgaggacattggggagcagttcgcagctgtcagcctggacaggactctccagtttggc
cacatgtccgtcacagtggagagacagatgatccaggaaaccaagggtgacacggtggcc
cctggggcagaggggctgctcaacctgcggccagacgacttcgtcttctacgtcgggggg
taccccagtaccttcacgccccctcccctgcttcgcttccccggctaccggggctgcatc
gagatggacacgctgaatgaggaggtggtcagcctctacaacttcgagaggaccttccag
ctggacacggctgtggacaggccttgtgcccgctccaagtcgaccggggacccgtggctc
acggacggctcctacctggacggcaccggcttcgcccgcatcagcttcgacagtcagatc
agcaccaccaagcgcttcgagcaggagctgcggctcgtgtcctacagcggggtgctcttc
ttcctgaagcagcagagccagttcctgtgcttggccgtgcaagaaggcagcctcgtgctg
ttgtatgactttggggctggcctgaaaaaggccgtcccactgcagcccccaccgcccctg
acctcggccagcaaggcgatccaggtgttcctgctggggggcagccgcaagcgtgtgctg
gtgcgtgtggagcgggccacggtgtacagcgtggagcaggacaatgatctggagctggcc
gacgcctactacctggggggcgtgccgcccgaccagctgcccccgagcctgcgacggctc
ttccccaccggaggctcagtccgtggctgcgtcaaaggcatcaaggccctgggcaagtat
gtggacctcaagcggctgaacacgacaggcgtgagcgccggctgcaccgccgacctgctg
gtggggcgcgccatgactttccatggccacggcttccttcgcctggcgctctcgaacgtg
gcaccgctcactggcaacgtctactccggcttcggcttccacagcgcccaggacagtgcc
ctgctctactaccgggcgtccccggatgggctatgccaggtgtccctgcagcagggccgt
gtgagcctacagctcctgaggactgaagtgaaaactcaagcgggcttcgccgatggtgcc
ccccattacgtcgccttctacagcaatgccacgggagtctggctgtatgtcgatgaccag
ctccagcagatgaagccccaccggggaccaccccccgagctccagccgcagcctgagggg
cccccgaggctcctcctgggaggcctgcctgagtctggcaccatttacaacttcagtggc
tgcatcagcaacgtcttcgtgcagcggctcctgggcccacagcgcgtatttgatctgcag
cagaacctgggcagcgtcaatgtgagcacgggctgtgcacccgccctgcaagcccagacc
ccgggcctggggcctagaggactgcaggccaccgcccggaaggcctcccgccgcagccgt
cagcccgcccggcatcctgcctgcatgctgcccccacacctcaggaccacccgagactcc
taccagtttgggggttccctgtccagtcacctggagtttgtgggcatcctggcccgacat
aggaactggcccagtctctccatgcacgtcctcccgcgaagctcccgaggcctcctcctc
ttcactgcccgtctgaggcccggcagcccctccctggcgctcttcctgagcaatggccac
ttcgttgcacagatggaaggcctcgggactcggctccgcgcccagagccgccagcgctcc
cggcctggccgctggcacaaggtctccgtgcgctgggagaagaaccggatcctgctggtg
acggacggggcccgggcctggagccaggaggggccgcaccggcagcaccagggggcagag
cacccccagccccacaccctctttgtgggcggcctcccggccagcagccacagctccaaa
cttccggtgaccgtcgggttcagcggctgtgtgaagagactgaggctgcacgggaggccc
ctgggggcccccacacggatggcaggggtcacaccctgcatcttgggccccctggaggcg
ggcctgttcttcccaggcagcgggggagttatcactttagacctcccaggagctacactg
cctgatgtgggcctggaactggaggtgcggcccctggcagtcaccggactgatcttccac
ttgggccaggcccggacgcccccctacttgcagttgcaggtgaccgagaagcaagtcctg
ctgcgggcggatgacggagcaggggagttctccacgtcagtgacccgcccctcagtgctg
tgtgatggccagtggcaccggctagcggtgatgaaaagcgggaatgtgctccggctggag
gtggacgcgcagagcaaccacaccgtgggccccttgctggcggctgcagctggtgcccca
gcccctctgtacctcgggggcctgcctgagcccatggccgtgcagccctggccccccgcc
tactgcggctgcatgaggaggctggcggtgaaccggtcccccgtcgccatgactcgctct
gtggaggtccacggggcagtgggggccagtggctgcccagccgcctag

Protein Sequence

>3911 : length: 3695
MAKRLCAGSALCVRGPRGPAPLLLVGLALLGAARAREEAGGGFSLHPPYFNLAEGARIAA
SATCGEEAPARGSPRPTEDLYCKLVGGPVAGGDPNQTIRGQYCDICTAANSNKAHPASNA
IDGTERWWQSPPLSRGLEYNEVNVTLDLGQVFHVAYVLIKFANSPRPDLWVLERSMDFGR
TYQPWQFFASSKRDCLERFGPQTLERITRDDAAICTTEYSRIVPLENGEIVVSLVNGRPG
AMNFSYSPLLREFTKATNVRLRFLRTNTLLGHLMGKALRDPTVTRRYYYSIKDISIGGRC
VCHGHADACDAKDPTDPFRLQCTCQHNTCGGTCDRCCPGFNQQPWKPATANSANECQSCN
CYGHATDCYYDPEVDRRRASQSLDGTYQGGGVCIDCQHHTTGVNCERCLPGFYRSPNHPL
DSPHVCRRCNCESDFTDGTCEDLTGRCYCRPNFSGERCDVCAEGFTGFPSCYPTPSSSND
TREQVLPAGQIVNCDCSAAGTQGNACRKDPRVGRCLCKPNFQGTHCELCAPGFYGPGCQP
CQCSSPGVADDRCDPDTGQCRCRVGFEGATCDRCAPGYFHFPLCQLCGCSPAGTLPEGCD
EAGRCLCQPEFAGPHCDRCRPGYHGFPNCQACTCDPRGALDQLCGAGGLCRCRPGYTGTA
CQECSPGFHGFPSCVPCHCSAEGSLHAACDPRSGQCSCRPRVTGLRCDTCVPGAYNFPYC
EAGSCHPAGLAPVDPALPEAQVPCMCRAHVEGPSCDRCKPGFWGLSPSNPEGCTRCSCDL
RGTLGGVAECQPGTGQCFCKPHVCGQACASCKDGFFGLDQADYFGCRSCRCDIGGALGQS
CEPRTGVCRCRPNTQGPTCSEPARDHYLPDLHHLRLELEEAATPEGHAVRFGFNPLEFEN
FSWRGYAQMAPVQPRIVARLNLTSPDLFWLVFRYVNRGAMSVSGRVSVREEGRSATCANC
TAQSQPVAFPPSTEPAFITVPQRGFGEPFVLNPGTWALRVEAEGVLLDYVVLLPSAYYEA
ALLQLRVTEACTYRPSAQQSGDNCLLYTHLPLDGFPSAAGLEALCRQDNSLPRPCPTEQL
SPSHPPLITCTGSDVDVQLQVAVPQPGRYALVVEYANEDARQEVGVAVHTPQRAPQQGLL
SLHPCLYSTLCRGTARDTQDHLAVFHLDSEASVRLTAEQARFFLHGVTLVPIEEFSPEFV
EPRVSCISSHGAFGPNSAACLPSRFPKPPQPIILRDCQVIPLPPGLPLTHAQDLTPAMSP
AGPRPRPPTAVDPDAEPTLLREPQATVVFTTHVPTLGRYAFLLHGYQPAHPTFPVEVLIN
AGRVWQGHANASFCPHGYGCRTLVVCEGQALLDVTHSELTVTVRVPKGRWLWLDYVLVVP
ENVYSFGYLREEPLDKSYDFISHCAAQGYHISPSSSSLFCRNAAASLSLFYNNGARPCGC
HEVGATGPTCEPFGGQCPCHAHVIGRDCSRCATGYWGFPNCRPCDCGARLCDELTGQCIC
PPRTIPPDCLLCQPQTFGCHPLVGCEECNCSGPGIQELTDPTCDTDSGQCKCRPNVTGRR
CDTCSPGFHGYPRCRPCDCHEAGTAPGVCDPLTGQCYCKENVQGPKCDQCSLGTFSLDAA
NPKGCTRCFCFGATERCRSSSYTRQEFVDMEGWVLLSTDRQVVPHERQPGTEMLRADLRH
VPEAVPEAFPELYWQAPPSYLGDRVSSYGGTLRYELHSETQRGDVFVPMESRPDVVLQGN
QMSITFLEPAYPTPGHVHRGQLQLVEGNFRHTETRNTVSREELMMVLASLEQLQIRALFS
QISSAVFLRRVALEVASPAGQGALASNVELCLCPASYRGDSCQECAPGFYRDVKGLFLGR
CVPCQCHGHSDRCLPGSGVCVDCQHNTEGAHCERCQAGFVSSRDDPSAPCVSCPCPLSVP
SNNFAEGCVLRGGRTQCLCKPGYAGASCERCAPGFFGNPLVLGSSCQPCDCSGNGDPNLL
FSDCDPLTGACRGCLRHTTGPRCEICAPGFYGNALLPGNCTRCDCTPCGTEACDPHSGHC
LCKAGVTGRRCDRCQEGHFGFDGCGGCRPCACGPAAEGSECHPQSGQCHCRPGTMGPQCR
ECAPGYWGLPEQGCRRCQCPGGRCDPHTGRCNCPPGLSGERCDTCSQQHQVPVPGGPVGH
SIHCEVCDHCVVLLLDDLERAGALLPAIHEQLRGINASSMAWARLHRLNASIADLQSQLR
SPLGPRHETAQQLEVLEQQSTSLGQDARRLGGQAVGTRDQASQLLAGTEATLGHAKTLLA
AIRAVDRTLSELMSQTGHLGLANASAPSGEQLLRTLAEVERLLWEMRARDLGAPQAAAEA
ELAAAQRLLARVQEQLSSLWEENQALATQTRDRLAQHEAGLMDLREALNRAVDATREAQE
LNSRNQERLEEALQRKQELSRDNATLQATLHAARDTLASVFRLLHSLDQAKEELERLAAS
LDGARTPLLQRMQTFSPAGSKLRLVEAAEAHAQQLGQLALNLSSIILDVNQDRLTQRAIE
ASNAYSRILQAVQAAEDAAGQALQQADHTWATVVRQGLVDRAQQLLANSTALEEAMLQEQ
QRLGLVWAALQGARTQLRDVRAKKDQLEAHIQAAQAMLAMDTDETSKKIAHAKAVAAEAQ
DTATRVQSQLQAMQENVERWQGQYEGLRGQDLGQAVLDAGHSVSTLEKTLPQLLAKLSIL
ENRGVHNASLALSASIGRVRELIAQARGAASKVKVPMKFNGRSGVQLRTPRDLADLAAYT
ALKFYLQGPEPEPGQGTEDRFVMYMGSRQATGDYMGVSLRDKKVHWVYQLGEAGPAVLSI
DEDIGEQFAAVSLDRTLQFGHMSVTVERQMIQETKGDTVAPGAEGLLNLRPDDFVFYVGG
YPSTFTPPPLLRFPGYRGCIEMDTLNEEVVSLYNFERTFQLDTAVDRPCARSKSTGDPWL
TDGSYLDGTGFARISFDSQISTTKRFEQELRLVSYSGVLFFLKQQSQFLCLAVQEGSLVL
LYDFGAGLKKAVPLQPPPPLTSASKAIQVFLLGGSRKRVLVRVERATVYSVEQDNDLELA
DAYYLGGVPPDQLPPSLRRLFPTGGSVRGCVKGIKALGKYVDLKRLNTTGVSAGCTADLL
VGRAMTFHGHGFLRLALSNVAPLTGNVYSGFGFHSAQDSALLYYRASPDGLCQVSLQQGR
VSLQLLRTEVKTQAGFADGAPHYVAFYSNATGVWLYVDDQLQQMKPHRGPPPELQPQPEG
PPRLLLGGLPESGTIYNFSGCISNVFVQRLLGPQRVFDLQQNLGSVNVSTGCAPALQAQT
PGLGPRGLQATARKASRRSRQPARHPACMLPPHLRTTRDSYQFGGSLSSHLEFVGILARH
RNWPSLSMHVLPRSSRGLLLFTARLRPGSPSLALFLSNGHFVAQMEGLGTRLRAQSRQRS
RPGRWHKVSVRWEKNRILLVTDGARAWSQEGPHRQHQGAEHPQPHTLFVGGLPASSHSSK
LPVTVGFSGCVKRLRLHGRPLGAPTRMAGVTPCILGPLEAGLFFPGSGGVITLDLPGATL
PDVGLELEVRPLAVTGLIFHLGQARTPPYLQLQVTEKQVLLRADDGAGEFSTSVTRPSVL
CDGQWHRLAVMKSGNVLRLEVDAQSNHTVGPLLAAAAGAPAPLYLGGLPEPMAVQPWPPA
YCGCMRRLAVNRSPVAMTRSVEVHGAVGASGCPAA



')