Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3880

Name

KRT19

Synonym

CK19|K19|K1CS;keratin 19;KRT19;keratin 19

Definition

40-kDa keratin intermediate filament|CK-19|cytokeratin 19|cytokeratin-19|keratin, type I cytoskeletal 19|keratin, type I, 40-kd|keratin-19

Position

17q21.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Disease

cirrhosis, biliary primary;GAD

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

3880

Links to all GeneRIF Items

3880

Links to iHOP

3880

Sequence Information

Nucleotide Sequence

>3880 : length: 1203
atgacttcctacagctatcgccagtcgtcggccacgtcgtccttcggaggcctgggcggc
ggctccgtgcgttttgggccgggggtcgcctttcgcgcgcccagcattcacgggggctcc
ggcggccgcggcgtatccgtgtcctccgcccgctttgtgtcctcgtcctcctcgggggcc
tacggcggcggctacggcggcgtcctgaccgcgtccgacgggctgctggcgggcaacgag
aagctaaccatgcagaacctcaacgaccgcctggcctcctacctggacaaggtgcgcgcc
ctggaggcggccaacggcgagctagaggtgaagatccgcgactggtaccagaagcagggg
cctgggccctcccgcgactacagccactactacacgaccatccaggacctgcgggacaag
attcttggtgccaccattgagaactccaggattgtcctgcagatcgacaatgcccgtctg
gctgcagatgacttccgaaccaagtttgagacggaacaggctctgcgcatgagcgtggag
gccgacatcaacggcctgcgcagggtgctggatgagctgaccctggccaggaccgacctg
gagatgcagatcgaaggcctgaaggaagagctggcctacctgaagaagaaccatgaggag
gaaatcagtacgctgaggggccaagtgggaggccaggtcagtgtggaggtggattccgct
ccgggcaccgatctcgccaagatcctgagtgacatgcgaagccaatatgaggtcatggcc
gagcagaaccggaaggatgctgaagcctggttcaccagccggactgaagaattgaaccgg
gaggtcgctggccacacggagcagctccagatgagcaggtccgaggttactgacctgcgg
cgcacccttcagggtcttgagattgagctgcagtcacagctgagcatgaaagctgccttg
gaagacacactggcagaaacggaggcgcgctttggagcccagctggcgcatatccaggcg
ctgatcagcggtattgaagcccagctgggcgatgtgcgagctgatagtgagcggcagaat
caggagtaccagcggctcatggacatcaagtcgcggctggagcaggagattgccacctac
cgcagcctgctcgagggacaggaagatcactacaacaatttgtctgcctccaaggtcctc
tga

Protein Sequence

>3880 : length: 400
MTSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSARFVSSSSSGA
YGGGYGGVLTASDGLLAGNEKLTMQNLNDRLASYLDKVRALEAANGELEVKIRDWYQKQG
PGPSRDYSHYYTTIQDLRDKILGATIENSRIVLQIDNARLAADDFRTKFETEQALRMSVE
ADINGLRRVLDELTLARTDLEMQIEGLKEELAYLKKNHEEEISTLRGQVGGQVSVEVDSA
PGTDLAKILSDMRSQYEVMAEQNRKDAEAWFTSRTEELNREVAGHTEQLQMSRSEVTDLR
RTLQGLEIELQSQLSMKAALEDTLAETEARFGAQLAHIQALISGIEAQLGDVRADSERQN
QEYQRLMDIKSRLEQEIATYRSLLEGQEDHYNNLSASKVL



')