Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3815

Name

KIT

Synonym

C-Kit|CD117|PBT|SCFR;v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog;KIT;v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog

Definition

mast/stem cell growth factor receptor Kit|p145 c-kit|piebald trait protein|proto-oncogene c-Kit|proto-oncogene tyrosine-protein kinase Kit|soluble KIT variant 1|tyrosine-protein kinase Kit|v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene-like protein

Position

4q11-q12

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Melanogenesis;KEGG PATHWAY;hsa04916

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

melanocyte development and pigmentation pathway;PID BioCarta;100108

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

C-MYB transcription factor network;PID Curated;200130

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Acute myeloid leukemia;KEGG PATHWAY;hsa05221

Disease

Mean corpuscular volume;NHGRI

Disease

Inherited disorders of amino acid metabolism;KEGG DISEASE

Disease

HEMATOLOGICAL;GAD

Disease

Leukemia, acute myeloid;OMIM

Disease

Gastrointestinal tumor;FunDO

Disease

Germ cell tumors;OMIM

Disease

leukemia, myeloid;GAD

Disease

Cancer;FunDO

Disease

Neurofibromatosis;FunDO

Disease

Infertility, Male;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Piebaldism;OMIM

Disease

METABOLIC;GAD

Disease

bone density;GAD

Disease

PSYCH;GAD

Disease

Nephritis;FunDO

Disease

Genetic disorders;KEGG DISEASE

Disease

Testicular dysfunction;FunDO

Disease

melanoma;GAD

Disease

Bipolar disorder;NHGRI

Disease

mean corpuscular volume;GAD

Disease

Mastocytosis with associated hematologic disorder;OMIM

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Acute myeloid leukemia (AML);KEGG DISEASE;H00003

Disease

Osteoporosis;FunDO

Disease

CANCER;GAD

Disease

Translocation, Genetic;GAD

Disease

Thyroid gland disease;FunDO

Disease

Mast cell leukemia;OMIM

Disease

Piebaldism;KEGG DISEASE;H00170

Disease

Gastrointestinal stromal tumor, somatic;OMIM

Disease

bipolar disorder;GAD

Disease

slow transit constipation;GAD

Disease

stomach cancer;GAD

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3815

Links to all GeneRIF Items

3815

Links to iHOP

3815

Sequence Information

Nucleotide Sequence

>3815 : length: 2931
atgagaggcgctcgcggcgcctgggattttctctgcgttctgctcctactgcttcgcgtc
cagacaggctcttctcaaccatctgtgagtccaggggaaccgtctccaccatccatccat
ccaggaaaatcagacttaatagtccgcgtgggcgacgagattaggctgttatgcactgat
ccgggctttgtcaaatggacttttgagatcctggatgaaacgaatgagaataagcagaat
gaatggatcacggaaaaggcagaagccaccaacaccggcaaatacacgtgcaccaacaaa
cacggcttaagcaattccatttatgtgtttgttagagatcctgccaagcttttccttgtt
gaccgctccttgtatgggaaagaagacaacgacacgctggtccgctgtcctctcacagac
ccagaagtgaccaattattccctcaaggggtgccaggggaagcctcttcccaaggacttg
aggtttattcctgaccccaaggcgggcatcatgatcaaaagtgtgaaacgcgcctaccat
cggctctgtctgcattgttctgtggaccaggagggcaagtcagtgctgtcggaaaaattc
atcctgaaagtgaggccagccttcaaagctgtgcctgttgtgtctgtgtccaaagcaagc
tatcttcttagggaaggggaagaattcacagtgacgtgcacaataaaagatgtgtctagt
tctgtgtactcaacgtggaaaagagaaaacagtcagactaaactacaggagaaatataat
agctggcatcacggtgacttcaattatgaacgtcaggcaacgttgactatcagttcagcg
agagttaatgattctggagtgttcatgtgttatgccaataatacttttggatcagcaaat
gtcacaacaaccttggaagtagtagataaaggattcattaatatcttccccatgataaac
actacagtatttgtaaacgatggagaaaatgtagatttgattgttgaatatgaagcattc
cccaaacctgaacaccagcagtggatctatatgaacagaaccttcactgataaatgggaa
gattatcccaagtctgagaatgaaagtaatatcagatacgtaagtgaacttcatctaacg
agattaaaaggcaccgaaggaggcacttacacattcctagtgtccaattctgacgtcaat
gctgccatagcatttaatgtttatgtgaatacaaaaccagaaatcctgacttacgacagg
ctcgtgaatggcatgctccaatgtgtggcagcaggattcccagagcccacaatagattgg
tatttttgtccaggaactgagcagagatgctctgcttctgtactgccagtggatgtgcag
acactaaactcatctgggccaccgtttggaaagctagtggttcagagttctatagattct
agtgcattcaagcacaatggcacggttgaatgtaaggcttacaacgatgtgggcaagact
tctgcctattttaactttgcatttaaaggtaacaacaaagagcaaatccatccccacacc
ctgttcactcctttgctgattggtttcgtaatcgtagctggcatgatgtgcattattgtg
atgattctgacctacaaatatttacagaaacccatgtatgaagtacagtggaaggttgtt
gaggagataaatggaaacaattatgtttacatagacccaacacaacttccttatgatcac
aaatgggagtttcccagaaacaggctgagttttgggaaaaccctgggtgctggagctttc
gggaaggttgttgaggcaactgcttatggcttaattaagtcagatgcggccatgactgtc
gctgtaaagatgctcaagccgagtgcccatttgacagaacgggaagccctcatgtctgaa
ctcaaagtcctgagttaccttggtaatcacatgaatattgtgaatctacttggagcctgc
accattggagggcccaccctggtcattacagaatattgttgctatggtgatcttttgaat
tttttgagaagaaaacgtgattcatttatttgttcaaagcaggaagatcatgcagaagct
gcactttataagaatcttctgcattcaaaggagtcttcctgcagcgatagtactaatgag
tacatggacatgaaacctggagtttcttatgttgtcccaaccaaggccgacaaaaggaga
tctgtgagaataggctcatacatagaaagagatgtgactcccgccatcatggaggatgac
gagttggccctagacttagaagacttgctgagcttttcttaccaggtggcaaagggcatg
gctttcctcgcctccaagaattgtattcacagagacttggcagccagaaatatcctcctt
actcatggtcggatcacaaagatttgtgattttggtctagccagagacatcaagaatgat
tctaattatgtggttaaaggaaacgctcgactacctgtgaagtggatggcacctgaaagc
attttcaactgtgtatacacgtttgaaagtgacgtctggtcctatgggatttttctttgg
gagctgttctctttaggaagcagcccctatcctggaatgccggtcgattctaagttctac
aagatgatcaaggaaggcttccggatgctcagccctgaacacgcacctgctgaaatgtat
gacataatgaagacttgctgggatgcagatcccctaaaaagaccaacattcaagcaaatt
gttcagctaattgagaagcagatttcagagagcaccaatcatatttactccaacttagca
aactgcagccccaaccgacagaagcccgtggtagaccattctgtgcggatcaattctgtc
ggcagcaccgcttcctcctcccagcctctgcttgtgcacgacgatgtctga

Protein Sequence

>3815 : length: 976
MRGARGAWDFLCVLLLLLRVQTGSSQPSVSPGEPSPPSIHPGKSDLIVRVGDEIRLLCTD
PGFVKWTFEILDETNENKQNEWITEKAEATNTGKYTCTNKHGLSNSIYVFVRDPAKLFLV
DRSLYGKEDNDTLVRCPLTDPEVTNYSLKGCQGKPLPKDLRFIPDPKAGIMIKSVKRAYH
RLCLHCSVDQEGKSVLSEKFILKVRPAFKAVPVVSVSKASYLLREGEEFTVTCTIKDVSS
SVYSTWKRENSQTKLQEKYNSWHHGDFNYERQATLTISSARVNDSGVFMCYANNTFGSAN
VTTTLEVVDKGFINIFPMINTTVFVNDGENVDLIVEYEAFPKPEHQQWIYMNRTFTDKWE
DYPKSENESNIRYVSELHLTRLKGTEGGTYTFLVSNSDVNAAIAFNVYVNTKPEILTYDR
LVNGMLQCVAAGFPEPTIDWYFCPGTEQRCSASVLPVDVQTLNSSGPPFGKLVVQSSIDS
SAFKHNGTVECKAYNDVGKTSAYFNFAFKGNNKEQIHPHTLFTPLLIGFVIVAGMMCIIV
MILTYKYLQKPMYEVQWKVVEEINGNNYVYIDPTQLPYDHKWEFPRNRLSFGKTLGAGAF
GKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMNIVNLLGAC
TIGGPTLVITEYCCYGDLLNFLRRKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNE
YMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELALDLEDLLSFSYQVAKGM
AFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIKNDSNYVVKGNARLPVKWMAPES
IFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGFRMLSPEHAPAEMY
DIMKTCWDADPLKRPTFKQIVQLIEKQISESTNHIYSNLANCSPNRQKPVVDHSVRINSV
GSTASSSQPLLVHDDV



')