Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3756

Name

KCNH1

Synonym

EAG|EAG1|Kv10.1|h-eag;potassium voltage-gated channel, subfamily H (eag-related), member 1;KCNH1;potassium voltage-gated channel, subfamily H (eag-related), member 1

Definition

EAG channel 1|ether-a-go-go potassium channel 1|ether-a-go-go, Drosophila, homolog of|hEAG1|potassium voltage-gated channel subfamily H member 1|voltage-gated potassium channel subunit Kv10.1

Position

1q32.2

Gene Type

protein-coding

External Links

Links to Entrez Gene

3756

Links to all GeneRIF Items

3756

Links to iHOP

3756

Sequence Information

Nucleotide Sequence

>3756 : length: 2889
atgaccatggctgggggcaggaggggactagtggcccctcaaaacacgtttctggagaat
attgttcggcggtccaatgatactaattttgtgttggggaatgctcagatagtggactgg
cctattgtgtacagcaatgatggattttgcaagctgtctggctatcacagggcagaagtg
atgcaaaaaagcagcacctgcagttttatgtatggggagctgactgataaagacacgatt
gaaaaagtgcggcaaacatttgagaactatgagatgaattcctttgaaattctgatgtac
aagaagaacaggacacctgtgtggttctttgtgaaaattgctccaattcgaaacgaacag
gataaagtggttttatttctttgcactttcagtgacataacagctttcaaacagccaatt
gaggatgattcatgtaaaggctgggggaagtttgctcggctgacaagagcactgacaagc
agcaggggtgtcctgcagcagctggctccaagcgtgcaaaaaggcgagaatgtccacaag
cactcccgcctggcagaggtcctacagctgggctcagacatccttccccagtacaagcaa
gaggcaccaaagactccccctcacatcatcttacattattgtgtttttaagaccacgtgg
gattggatcatcttgatcttgaccttctatacagccatcttggtcccttataatgtctcc
ttcaaaaccaggcagaataatgtggcctggctggttgttgatagcatcgtggatgttatc
tttttggtggacattgtgctcaattttcataccacctttgttggaccagcaggggaggtg
atttctgaccccaaacttatccgcatgaactacctgaagacgtggtttgtgattgacctt
ctgtcctgtttgccatatgatgtcatcaacgcttttgagaacgtggatgagggcatcagc
agcctgttcagctctctaaaagttgtccggctgctccgtcttgggcgagtggcccgtaag
ctggaccactacattgaatatggagctgctgtgctggtcctgctggtgtgtgtgtttggg
ctggctgcacactggatggcctgcatctggtacagcattggggactatgagatctttgac
gaggacaccaagacaatccgcaacaacagctggctgtaccaactagcgatggacattggc
accccttaccagtttaatgggtctggctcagggaagtgggaaggtggtcccagcaagaat
tctgtctacatctcctcgttgtatttcacaatgaccagcctcaccagtgtgggctttggg
aacatcgccccatccacagacattgagaagatctttgcagtggccatcatgatgattggc
tcacttctctatgccaccatcttcgggaatgtgacgactattttccaacagatgtatgcc
aacaccaacagataccatgagatgctcaacagtgttcgggacttcctgaagctctaccag
gtgccaaaaggattgagtgagcgagtaatggattatattgtgtccacttggtccatgtcc
agaggcattgacacagagaaggtcctgcagatctgccccaaggacatgagagccgacatc
tgcgtgcacctgaaccgcaaggtgttcaaggagcacccggccttccggctggccagtgat
ggctgcctccgggcactggccatggagttccagacggtgcactgtgccccaggggacctc
atctaccatgcaggagagagcgttgacagcctctgctttgtggtttctggctccctggag
gtgatccaagatgatgaggtggtggccattctaggaaaaggagacgtgtttggagatgtg
ttctggaaggaagccacccttgcccagtcctgtgccaatgttagggccttgacctactgt
gatctgcatgtgatcaagcgggatgccctgcagaaagtgctggaattctacacggccttc
tcccattccttctcccggaacctgattctgacgtacaacttgaggaagaggattgtgttc
cggaagatcagcgatgtgaaacgtgaagaggaagaacgcatgaaacgaaagaatgaggcc
cccctgatcttgcccccggaccaccctgtccggcgcctcttccagagattccgacagcag
aaagaggccaggctggcagctgagagagggggccgggacctggatgacctagatgtggag
aagggcaatgtccttacagagcatgcctccgccaaccacagcctcgtgaaggccagcgtg
gtcaccgtgcgtgagagtcctgccacgcccgtatccttccaggcagcctccacctccggg
gtgccagaccacgcaaagctacaggcgccagggtccgagtgcctgggccccaaggggggc
gggggcgattgtgccaagcgcaaaagctgggcccgcttcaaagatgcttgcgggaagagt
gaggactggaacaaggtgtccaaggctgagtcgatggagacacttcccgagaggacaaaa
gcgtcaggcgaggccacactgaagaagacagactcgtgtgacagtggcatcaccaagagc
gacttgcgcctggacaacgtgggtgaggccaggagtccccaggatcggagtcccatcctg
gcagaggtcaagcattcgttctaccccatccctgagcagacgctgcaggccacagtcctg
gaggtgaggcacgagctgaaggaggacatcaaggccttaaacgccaaaatgaccaatatt
gagaaacagctctctgagatactcaggatattaacttccagaagatcctctcagtctcct
caggagttgtttgaaatatcgaggccacagtccccagaatcagagagagacatttttgga
gccagctga

Protein Sequence

>3756 : length: 962
MTMAGGRRGLVAPQNTFLENIVRRSNDTNFVLGNAQIVDWPIVYSNDGFCKLSGYHRAEV
MQKSSTCSFMYGELTDKDTIEKVRQTFENYEMNSFEILMYKKNRTPVWFFVKIAPIRNEQ
DKVVLFLCTFSDITAFKQPIEDDSCKGWGKFARLTRALTSSRGVLQQLAPSVQKGENVHK
HSRLAEVLQLGSDILPQYKQEAPKTPPHIILHYCVFKTTWDWIILILTFYTAILVPYNVS
FKTRQNNVAWLVVDSIVDVIFLVDIVLNFHTTFVGPAGEVISDPKLIRMNYLKTWFVIDL
LSCLPYDVINAFENVDEGISSLFSSLKVVRLLRLGRVARKLDHYIEYGAAVLVLLVCVFG
LAAHWMACIWYSIGDYEIFDEDTKTIRNNSWLYQLAMDIGTPYQFNGSGSGKWEGGPSKN
SVYISSLYFTMTSLTSVGFGNIAPSTDIEKIFAVAIMMIGSLLYATIFGNVTTIFQQMYA
NTNRYHEMLNSVRDFLKLYQVPKGLSERVMDYIVSTWSMSRGIDTEKVLQICPKDMRADI
CVHLNRKVFKEHPAFRLASDGCLRALAMEFQTVHCAPGDLIYHAGESVDSLCFVVSGSLE
VIQDDEVVAILGKGDVFGDVFWKEATLAQSCANVRALTYCDLHVIKRDALQKVLEFYTAF
SHSFSRNLILTYNLRKRIVFRKISDVKREEEERMKRKNEAPLILPPDHPVRRLFQRFRQQ
KEARLAAERGGRDLDDLDVEKGNVLTEHASANHSLVKASVVTVRESPATPVSFQAASTSG
VPDHAKLQAPGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTK
ASGEATLKKTDSCDSGITKSDLRLDNVGEARSPQDRSPILAEVKHSFYPIPEQTLQATVL
EVRHELKEDIKALNAKMTNIEKQLSEILRILTSRRSSQSPQELFEISRPQSPESERDIFG
AS



')