Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3717

Name

JAK2

Synonym

JTK10;Janus kinase 2;JAK2;Janus kinase 2

Definition

JAK-2|Janus kinase 2 (a protein tyrosine kinase)|tyrosine-protein kinase JAK2

Position

9p24

Gene Type

protein-coding

Pathways and Diseases

Pathway

S1P3 pathway;PID Curated;200035

Pathway

ifn gamma signaling pathway;PID BioCarta;100138

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Interferon-gamma signaling pathway;PANTHER;P00035

Pathway

CXCR4-mediated signaling events;PID Curated;200083

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

il 3 signaling pathway;PID BioCarta;100128

Pathway

EPO signaling pathway;PID Curated;200157

Pathway

PDGF signaling pathway;PANTHER;P00047

Pathway

growth hormone signaling pathway;PID BioCarta;100155

Pathway

epo signaling pathway;PID BioCarta;100175

Pathway

Inflammation mediated by chemokine and cytokine signaling pathway;PANTHER;P00031

Pathway

PI3 kinase pathway;PANTHER;P00048

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

inhibition of cellular proliferation by gleevec;PID BioCarta;100154

Pathway

Adipocytokine signaling pathway;KEGG PATHWAY;hsa04920

Pathway

ErbB2/ErbB3 signaling events;PID Curated;200119

Pathway

bioactive peptide induced signaling pathway;PID BioCarta;100226

Pathway

no2-dependent il-12 pathway in nk cells;PID BioCarta;100093

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Endothelins;PID Curated;200004

Pathway

JAK/STAT signaling pathway;PANTHER;P00038

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

il12 and stat4 dependent signaling pathway in th1 development;PID BioCarta;100133

Pathway

erythropoietin mediated neuroprotection through nf-kb;PID BioCarta;100176

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

tpo signaling pathway;PID BioCarta;100012

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Chemokine signaling pathway;KEGG PATHWAY;hsa04062

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

ErbB4 signaling events;PID Curated;200009

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

Signaling events mediated by Stem cell factor receptor (c-Kit);PID Curated;200156

Pathway

GMCSF-mediated signaling events;PID Curated;200015

Pathway

chaperones modulate interferon signaling pathway;PID BioCarta;100016

Disease

myeloproliferative neoplasms;GAD

Disease

leukemia, myeloid;GAD

Disease

HEMATOLOGICAL;GAD

Disease

Leukemia, Myelomonocytic, Chronic;GAD

Disease

Combined immunodeficiency;FunDO

Disease

Cancer;FunDO

Disease

Leukemia, Myeloid, Acute;GAD

Disease

Down syndrome;FunDO

Disease

Myeloproliferative neoplasms;NHGRI

Disease

Myelofibrosis, idiopathic;OMIM

Disease

Choriocarcinoma;FunDO

Disease

Thrombocythemia, essential;OMIM

Disease

IMMUNE;GAD

Disease

Cancers of haematopoietic and lymphoid tissues;KEGG DISEASE

Disease

Rheumatoid arthritis;FunDO

Disease

Budd-Chiari syndrome hematology indices polycythemia vera;GAD

Disease

Polycythemia vera;KEGG DISEASE;H00012

Disease

Ulcerative colitis;NHGRI

Disease

Stroke;FunDO

Disease

Hematologic Neoplasms;GAD

Disease

thrombocythemia;GAD

Disease

Primary biliary cirrhosis;FunDO

Disease

ulcerative colitis;GAD

Disease

myelofibrosis;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

myelofibrosis myeloproliferative disorder polycythemia vera thrombocythemia;GAD

Disease

Crohn's disease;GAD

Disease

Polycythemia;FunDO

Disease

Crohn's disease;NHGRI

Disease

Budd-Chiari syndrome;OMIM

Disease

Cancers;KEGG DISEASE

Disease

Myeloproliferative disease;FunDO

Disease

Primary Myelofibrosis;GAD

Disease

Abortion;FunDO

Disease

Polycythemia vera;OMIM

Disease

Translocation, Genetic;GAD

Disease

Myeloproliferative disorder with erythrocytosis;OMIM

Disease

thromboembolism, venous;GAD

Disease

Hematopoietic system disease;FunDO

Disease

Thrombophilia;FunDO

Disease

Leukemia, acute myelogenous;OMIM

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3717

Links to all GeneRIF Items

3717

Links to iHOP

3717

Sequence Information

Nucleotide Sequence

>3717 : length: 3399
atgggaatggcctgccttacgatgacagaaatggagggaacatccacctcttctatatat
cagaatggtgatatttctggaaatgccaattctatgaagcaaatagatccagttcttcag
gtgtatctttaccattcccttgggaaatctgaggcagattatctgacctttccatctggg
gagtatgttgcagaagaaatctgtattgctgcttctaaagcttgtggtatcacacctgtg
tatcataatatgtttgctttaatgagtgaaacagaaaggatctggtatccacccaaccat
gtcttccatatagatgagtcaaccaggcataatgtactctacagaataagattttacttt
cctcgttggtattgcagtggcagcaacagagcctatcggcatggaatatctcgaggtgct
gaagctcctcttcttgatgactttgtcatgtcttacctctttgctcagtggcggcatgat
tttgtgcacggatggataaaagtacctgtgactcatgaaacacaggaagaatgtcttggg
atggcagtgttagatatgatgagaatagccaaagaaaacgatcaaaccccactggccatc
tataactctatcagctacaagacattcttaccaaaatgtattcgagcaaagatccaagac
tatcatattttgacaaggaagcgaataaggtacagatttcgcagatttattcagcaattc
agccaatgcaaagccactgccagaaacttgaaacttaagtatcttataaatctggaaact
ctgcagtctgccttctacacagagaaatttgaagtaaaagaacctggaagtggtccttca
ggtgaggagatttttgcaaccattataataactggaaacggtggaattcagtggtcaaga
gggaaacataaagaaagtgagacactgacagaacaggatttacagttatattgcgatttt
cctaatattattgatgtcagtattaagcaagcaaaccaagagggttcaaatgaaagccga
gttgtaactatccataagcaagatggtaaaaatctggaaattgaacttagctcattaagg
gaagctttgtctttcgtgtcattaattgatggatattatagattaactgcagatgcacat
cattacctctgtaaagaagtagcacctccagccgtgcttgaaaatatacaaagcaactgt
catggcccaatttcgatggattttgccattagtaaactgaagaaagcaggtaatcagact
ggactgtatgtacttcgatgcagtcctaaggactttaataaatattttttgacttttgct
gtcgagcgagaaaatgtcattgaatataaacactgtttgattacaaaaaatgagaatgaa
gagtacaacctcagtgggacaaagaagaacttcagcagtcttaaagatcttttgaattgt
taccagatggaaactgttcgctcagacaatataattttccagtttactaaatgctgtccc
ccaaagccaaaagataaatcaaaccttctagtcttcagaacgaatggtgtttctgatgta
ccaacctcaccaacattacagaggcctactcatatgaaccaaatggtgtttcacaaaatc
agaaatgaagatttgatatttaatgaaagccttggccaaggcacttttacaaagattttt
aaaggcgtacgaagagaagtaggagactacggtcaactgcatgaaacagaagttctttta
aaagttctggataaagcacacagaaactattcagagtctttctttgaagcagcaagtatg
atgagcaagctttctcacaagcatttggttttaaattatggagtatgtgtctgtggagac
gagaatattctggttcaggagtttgtaaaatttggatcactagatacatatctgaaaaag
aataaaaattgtataaatatattatggaaacttgaagttgctaaacagttggcatgggcc
atgcattttctagaagaaaacacccttattcatgggaatgtatgtgccaaaaatattctg
cttatcagagaagaagacaggaagacaggaaatcctcctttcatcaaacttagtgatcct
ggcattagtattacagttttgccaaaggacattcttcaggagagaataccatgggtacca
cctgaatgcattgaaaatcctaaaaatttaaatttggcaacagacaaatggagttttggt
accactttgtgggaaatctgcagtggaggagataaacctctaagtgctctggattctcaa
agaaagctacaattttatgaagataggcatcagcttcctgcaccaaagtgggcagaatta
gcaaaccttataaataattgtatggattatgaaccagatttcaggccttctttcagagcc
atcatacgagatcttaacagtttgtttactccagattatgaactattaacagaaaatgac
atgttaccaaatatgaggataggtgccctggggttttctggtgcctttgaagaccgggat
cctacacagtttgaagagagacatttgaaatttctacagcaacttggcaagggtaatttt
gggagtgtggagatgtgccggtatgaccctctacaggacaacactggggaggtggtcgct
gtaaaaaagcttcagcatagtactgaagagcacctaagagactttgaaagggaaattgaa
atcctgaaatccctacagcatgacaacattgtaaagtacaagggagtgtgctacagtgct
ggtcggcgtaatctaaaattaattatggaatatttaccatatggaagtttacgagactat
cttcaaaaacataaagaacggatagatcacataaaacttctgcagtacacatctcagata
tgcaagggtatggagtatcttggtacaaaaaggtatatccacagggatctggcaacgaga
aatatattggtggagaacgagaacagagttaaaattggagattttgggttaaccaaagtc
ttgccacaagacaaagaatactataaagtaaaagaacctggtgaaagtcccatattctgg
tatgctccagaatcactgacagagagcaagttttctgtggcctcagatgtttggagcttt
ggagtggttctgtatgaacttttcacatacattgagaagagtaaaagtccaccagcggaa
tttatgcgtatgattggcaatgacaaacaaggacagatgatcgtgttccatttgatagaa
cttttgaagaataatggaagattaccaagaccagatggatgcccagatgagatctatatg
atcatgacagaatgctggaacaataatgtaaatcaacgcccctcctttagggatctagct
cttcgagtggatcaaataagggataacatggctggatga

Protein Sequence

>3717 : length: 1132
MGMACLTMTEMEGTSTSSIYQNGDISGNANSMKQIDPVLQVYLYHSLGKSEADYLTFPSG
EYVAEEICIAASKACGITPVYHNMFALMSETERIWYPPNHVFHIDESTRHNVLYRIRFYF
PRWYCSGSNRAYRHGISRGAEAPLLDDFVMSYLFAQWRHDFVHGWIKVPVTHETQEECLG
MAVLDMMRIAKENDQTPLAIYNSISYKTFLPKCIRAKIQDYHILTRKRIRYRFRRFIQQF
SQCKATARNLKLKYLINLETLQSAFYTEKFEVKEPGSGPSGEEIFATIIITGNGGIQWSR
GKHKESETLTEQDLQLYCDFPNIIDVSIKQANQEGSNESRVVTIHKQDGKNLEIELSSLR
EALSFVSLIDGYYRLTADAHHYLCKEVAPPAVLENIQSNCHGPISMDFAISKLKKAGNQT
GLYVLRCSPKDFNKYFLTFAVERENVIEYKHCLITKNENEEYNLSGTKKNFSSLKDLLNC
YQMETVRSDNIIFQFTKCCPPKPKDKSNLLVFRTNGVSDVPTSPTLQRPTHMNQMVFHKI
RNEDLIFNESLGQGTFTKIFKGVRREVGDYGQLHETEVLLKVLDKAHRNYSESFFEAASM
MSKLSHKHLVLNYGVCVCGDENILVQEFVKFGSLDTYLKKNKNCINILWKLEVAKQLAWA
MHFLEENTLIHGNVCAKNILLIREEDRKTGNPPFIKLSDPGISITVLPKDILQERIPWVP
PECIENPKNLNLATDKWSFGTTLWEICSGGDKPLSALDSQRKLQFYEDRHQLPAPKWAEL
ANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRD
PTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIE
ILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQI
CKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFW
YAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIE
LLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG



')