Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3714

Name

JAG2

Synonym

HJ2|SER2;jagged 2;JAG2;jagged 2

Definition

protein jagged-2

Position

14q32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch signaling pathway;KEGG PATHWAY;hsa04330

Pathway

Notch signaling pathway;PANTHER;P00045

Pathway

Notch signaling pathway;PID Curated;200013

Pathway

Signaling by Notch;Reactome;REACT:299

Pathway

Angiogenesis;PANTHER;P00005

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

3714

Links to all GeneRIF Items

3714

Links to iHOP

3714

Sequence Information

Nucleotide Sequence

>3714 : length: 3717
atgcgggcgcagggccgggggcgccttccccggcggctgctgctgctgctggcgctctgg
gtgcaggcggcgcggcccatgggctatttcgagctgcagctgagcgcgctgcggaacgtg
aacggggagctgctgagcggcgcctgctgtgacggcgacggccggacaacgcgcgcgggg
ggctgcggccacgacgagtgcgacacgtacgtgcgcgtgtgccttaaggagtaccaggcc
aaggtgacgcccacggggccctgcagctacggccacggcgccacgcccgtgctgggcggc
aactccttctacctgccgccggcgggcgctgcgggggaccgagcgcgggcgcgggcccgg
gccggcggcgaccaggacccgggcctcgtcgtcatccccttccagttcgcctggccgcgc
tcctttaccctcatcgtggaggcctgggactgggacaacgataccaccccgaatgaggag
ctgctgatcgagcgagtgtcgcatgccggcatgatcaacccggaggaccgctggaagagc
ctgcacttcagcggccacgtggcgcacctggagctgcagatccgcgtgcgctgcgacgag
aactactacagcgccacttgcaacaagttctgccggccccgcaacgactttttcggccac
tacacctgcgaccagtacggcaacaaggcctgcatggacggctggatgggcaaggagtgc
aaggaagctgtgtgtaaacaagggtgtaatttgctccacgggggatgcaccgtgcctggg
gagtgcaggtgcagctacggctggcaagggaggttctgcgatgagtgtgtcccctacccc
ggctgcgtgcatggcagttgtgtggagccctggcagtgcaactgtgagaccaactggggc
ggcctgctctgtgacaaagacctgaactactgtggcagccaccacccctgcaccaacgga
ggcacgtgcatcaacgccgagcctgaccagtaccgctgcacctgccctgacggctactcg
ggcaggaactgtgagaaggctgagcacgcctgcacctccaacccgtgtgccaacgggggc
tcttgccatgaggtgccgtccggcttcgaatgccactgcccatcgggctggagcgggccc
acctgtgcccttgacatcgatgagtgtgcttcgaacccgtgtgcggccggtggcacctgt
gtggaccaggtggacggctttgagtgcatctgccccgagcagtgggtgggggccacctgc
cagctggacgccaatgagtgtgaagggaagccatgccttaacgctttttcttgcaaaaac
ctgattggcggctattactgtgattgcatcccgggctggaagggcatcaactgccatatc
aacgtcaacgactgtcgcgggcagtgtcagcatgggggcacctgcaaggacctggtgaac
gggtaccagtgtgtgtgcccacggggcttcggaggccggcattgcgagctggaacgagac
gagtgtgccagcagcccctgccacagcggcggcctctgcgaggacctggccgacggcttc
cactgccactgcccccagggcttctccgggcctctctgtgaggtggatgtcgacctttgt
gagccaagcccctgccggaacggcgctcgctgctataacctggagggtgactattactgc
gcctgccctgatgactttggtggcaagaactgctccgtgccccgcgagccgtgccctggc
ggggcctgcagagtgatcgatggctgcgggtcagacgcggggcctgggatgcctggcaca
gcagcctccggcgtgtgtggcccccatggacgctgcgtcagccagccagggggcaacttt
tcctgcatctgtgacagtggctttactggcacctactgccatgagaacattgacgactgc
ctgggccagccctgccgcaatgggggcacatgcatcgatgaggtggacgccttccgctgc
ttctgccccagcggctgggagggcgagctctgcgacaccaatcccaacgactgccttccc
gatccctgccacagccgcggccgctgctacgacctggtcaatgacttctactgtgcgtgc
gacgacggctggaagggcaagacctgccactcacgcgagttccagtgcgatgcctacacc
tgcagcaacggtggcacctgctacgacagcggcgacaccttccgctgcgcctgccccccc
ggctggaagggcagcacctgcgccgtcgccaagaacagcagctgcctgcccaacccctgt
gtgaatggtggcacctgcgtgggcagcggggcctccttctcctgcatctgccgggacggc
tgggagggtcgtacttgcactcacaataccaacgactgcaaccctctgccttgctacaat
ggtggcatctgtgttgacggcgtcaactggttccgctgcgagtgtgcacctggcttcgcg
gggcctgactgccgcatcaacatcgacgagtgccagtcctcgccctgtgcctacggggcc
acgtgtgtggatgagatcaacgggtatcgctgtagctgcccacccggccgagccggcccc
cggtgccaggaagtgatcgggttcgggagatcctgctggtcccggggcactccgttccca
cacggaagctcctgggtggaagactgcaacagctgccgctgcctggatggccgccgtgac
tgcagcaaggtgtggtgcggatggaagccttgtctgctggccggccagcccgaggccctg
agcgcccagtgcccactggggcaaaggtgcctggagaaggccccaggccagtgtctgcga
ccaccctgtgaggcctggggggagtgcggcgcagaagagccaccgagcaccccctgcctg
ccacgctccggccacctggacaataactgtgcccgcctcaccttgcatttcaaccgtgac
cacgtgccccagggcaccacggtgggcgccatttgctccgggatccgctccctgccagcc
acaagggctgtggcacgggaccgcctgctggtgttgctttgcgaccgggcgtcctcgggg
gccagtgccgtggaggtggccgtgtccttcagccctgccagggacctgcctgacagcagc
ctgatccagggcgcggcccacgccatcgtggccgccatcacccagcgggggaacagctca
ctgctcctggctgtcaccgaggtcaaggtggagacggttgttacgggcggctcttccaca
ggtctgctggtgcctgtgctgtgtggtgccttcagcgtgctgtggctggcgtgcgtggtc
ctgtgcgtgtggtggacacgcaagcgcaggaaagagcgggagaggagccggctgccgcgg
gaggagagcgccaacaaccagtgggccccgctcaaccccatccgcaaccccatcgagcgg
ccggggggccacaaggacgtgctctaccagtgcaagaacttcacgccgccgccgcgcagg
gcggacgaggcgctgcccgggccggccggccacgcggccgtcagggaggatgaggaggac
gaggatctgggccgcggtgaggaggactccctggaggcggagaagttcctctcacacaaa
ttcaccaaagatcctggccgctcgccggggaggccggcccactgggcctcaggccccaaa
gtggacaaccgcgcggtcaggagcatcaatgaggcccgctacgccggcaaggagtag

Protein Sequence

>3714 : length: 1238
MRAQGRGRLPRRLLLLLALWVQAARPMGYFELQLSALRNVNGELLSGACCDGDGRTTRAG
GCGHDECDTYVRVCLKEYQAKVTPTGPCSYGHGATPVLGGNSFYLPPAGAAGDRARARAR
AGGDQDPGLVVIPFQFAWPRSFTLIVEAWDWDNDTTPNEELLIERVSHAGMINPEDRWKS
LHFSGHVAHLELQIRVRCDENYYSATCNKFCRPRNDFFGHYTCDQYGNKACMDGWMGKEC
KEAVCKQGCNLLHGGCTVPGECRCSYGWQGRFCDECVPYPGCVHGSCVEPWQCNCETNWG
GLLCDKDLNYCGSHHPCTNGGTCINAEPDQYRCTCPDGYSGRNCEKAEHACTSNPCANGG
SCHEVPSGFECHCPSGWSGPTCALDIDECASNPCAAGGTCVDQVDGFECICPEQWVGATC
QLDANECEGKPCLNAFSCKNLIGGYYCDCIPGWKGINCHINVNDCRGQCQHGGTCKDLVN
GYQCVCPRGFGGRHCELERDECASSPCHSGGLCEDLADGFHCHCPQGFSGPLCEVDVDLC
EPSPCRNGARCYNLEGDYYCACPDDFGGKNCSVPREPCPGGACRVIDGCGSDAGPGMPGT
AASGVCGPHGRCVSQPGGNFSCICDSGFTGTYCHENIDDCLGQPCRNGGTCIDEVDAFRC
FCPSGWEGELCDTNPNDCLPDPCHSRGRCYDLVNDFYCACDDGWKGKTCHSREFQCDAYT
CSNGGTCYDSGDTFRCACPPGWKGSTCAVAKNSSCLPNPCVNGGTCVGSGASFSCICRDG
WEGRTCTHNTNDCNPLPCYNGGICVDGVNWFRCECAPGFAGPDCRINIDECQSSPCAYGA
TCVDEINGYRCSCPPGRAGPRCQEVIGFGRSCWSRGTPFPHGSSWVEDCNSCRCLDGRRD
CSKVWCGWKPCLLAGQPEALSAQCPLGQRCLEKAPGQCLRPPCEAWGECGAEEPPSTPCL
PRSGHLDNNCARLTLHFNRDHVPQGTTVGAICSGIRSLPATRAVARDRLLVLLCDRASSG
ASAVEVAVSFSPARDLPDSSLIQGAAHAIVAAITQRGNSSLLLAVTEVKVETVVTGGSST
GLLVPVLCGAFSVLWLACVVLCVWWTRKRRKERERSRLPREESANNQWAPLNPIRNPIER
PGGHKDVLYQCKNFTPPPRRADEALPGPAGHAAVREDEEDEDLGRGEEDSLEAEKFLSHK
FTKDPGRSPGRPAHWASGPKVDNRAVRSINEARYAGKE



')