Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3691

Name

ITGB4

Synonym

CD104;integrin, beta 4;ITGB4;integrin, beta 4

Definition

CD104 antigen|GP150|integrin beta-4|integrin beta-4 subunit

Position

17q25

Gene Type

protein-coding

Pathways and Diseases

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

Validated transcriptional targets of AP1 family members Fra1 and Fra2;PID Curated;200044

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Disease

Epidermolysis bullosa, junctional, with pyloric atresia;OMIM

Disease

Epidermolysis bullosa, junctional, non-Herlitz type;OMIM

Disease

Epidermolysis bullosa of hands and feet;OMIM

Disease

Pemphigoid, Bullous;FunDO

Disease

Cancer;FunDO

Disease

Skin disease, Genetic;FunDO

External Links

Links to Entrez Gene

3691

Links to all GeneRIF Items

3691

Links to iHOP

3691

Sequence Information

Nucleotide Sequence

>3691 : length: 5469
atggcagggccacgccccagcccatgggccaggctgctcctggcagccttgatcagcgtc
agcctctctgggaccttggcaaaccgctgcaagaaggccccagtgaagagctgcacggag
tgtgtccgtgtggataaggactgcgcctactgcacagacgagatgttcagggaccggcgc
tgcaacacccaggcggagctgctggccgcgggctgccagcgggagagcatcgtggtcatg
gagagcagcttccaaatcacagaggagacccagattgacaccaccctgcggcgcagccag
atgtccccccaaggcctgcgggtccgtctgcggcccggtgaggagcggcattttgagctg
gaggtgtttgagccactggagagccccgtggacctgtacatcctcatggacttctccaac
tccatgtccgatgatctggacaacctcaagaagatggggcagaacctggctcgggtcctg
agccagctcaccagcgactacactattggatttggcaagtttgtggacaaagtcagcgtc
ccgcagacggacatgaggcctgagaagctgaaggagccctggcccaacagtgaccccccc
ttctccttcaagaacgtcatcagcctgacagaagatgtggatgagttccggaataaactg
cagggagagcggatctcaggcaacctggatgctcctgagggcggcttcgatgccatcctg
cagacagctgtgtgcacgagggacattggctggcgcccggacagcacccacctgctggtc
ttctccaccgagtcagccttccactatgaggctgatggcgccaacgtgctggctggcatc
atgagccgcaacgatgaacggtgccacctggacaccacgggcacctacacccagtacagg
acacaggactacccgtcggtgcccaccctggtgcgcctgctcgccaagcacaacatcatc
cccatctttgctgtcaccaactactcctatagctactacgagaagcttcacacctatttc
cctgtctcctcactgggggtgctgcaggaggactcgtccaacatcgtggagctgctggag
gaggccttcaatcggatccgctccaacctggacatccgggccctagacagcccccgaggc
cttcggacagaggtcacctccaagatgttccagaagacgaggactgggtcctttcacatc
cggcggggggaagtgggtatataccaggtgcagctgcgggcccttgagcacgtggatggg
acgcacgtgtgccagctgccggaggaccagaagggcaacatccatctgaaaccttccttc
tccgacggcctcaagatggacgcgggcatcatctgtgatgtgtgcacctgcgagctgcaa
aaagaggtgcggtcagctcgctgcagcttcaacggagacttcgtgtgcggacagtgtgtg
tgcagcgagggctggagtggccagacctgcaactgctccaccggctctctgagtgacatt
cagccctgcctgcgggagggcgaggacaagccgtgctccggccgtggggagtgccagtgc
gggcactgtgtgtgctacggcgaaggccgctacgagggtcagttctgcgagtatgacaac
ttccagtgtccccgcacttccgggttcctctgcaatgaccgaggacgctgctccatgggc
cagtgtgtgtgtgagcctggttggacaggcccaagctgtgactgtcccctcagcaatgcc
acctgcatcgacagcaatgggggcatctgtaatggacgtggccactgtgagtgtggccgc
tgccactgccaccagcagtcgctctacacggacaccatctgcgagatcaactactcggcg
atccacccgggcctctgcgaggacctacgctcctgcgtgcagtgccaggcgtggggcacc
ggcgagaagaaggggcgcacgtgtgaggaatgcaacttcaaggtcaagatggtggacgag
cttaagagagccgaggaggtggtggtgcgctgctccttccgggacgaggatgacgactgc
acctacagctacaccatggaaggtgacggcgcccctgggcccaacagcactgtcctggtg
cacaagaagaaggactgccctccgggctccttctggtggctcatccccctgctcctcctc
ctcctgccgctcctggccctgctactgctgctatgctggaagtactgtgcctgctgcaag
gcctgcctggcacttctcccgtgctgcaaccgaggtcacatggtgggctttaaggaagac
cactacatgctgcgggagaacctgatggcctctgaccacttggacacgcccatgctgcgc
agcgggaacctcaagggccgtgacgtggtccgctggaaggtcaccaacaacatgcagcgg
cctggctttgccactcatgccgccagcatcaaccccacagagctggtgccctacgggctg
tccttgcgcctggcccgcctttgcaccgagaacctgctgaagcctgacactcgggagtgc
gcccagctgcgccaggaggtggaggagaacctgaacgaggtctacaggcagatctccggt
gtacacaagctccagcagaccaagttccggcagcagcccaatgccgggaaaaagcaagac
cacaccattgtggacacagtgctgatggcgccccgctcggccaagccggccctgctgaag
cttacagagaagcaggtggaacagagggccttccacgacctcaaggtggcccccggctac
tacaccctcactgcagaccaggacgcccggggcatggtggagttccaggagggcgtggag
ctggtggacgtacgggtgcccctctttatccggcctgaggatgacgacgagaagcagctg
ctggtggaggccatcgacgtgcccgcaggcactgccaccctcggccgccgcctggtaaac
atcaccatcatcaaggagcaagccagagacgtggtgtcctttgagcagcctgagttctcg
gtcagccgcggggaccaggtggcccgcatccctgtcatccggcgtgtcctggacggcggg
aagtcccaggtctcctaccgcacacaggatggcaccgcgcagggcaaccgggactacatc
cccgtggagggtgagctgctgttccagcctggggaggcctggaaagagctgcaggtgaag
ctcctggagctgcaagaagttgactccctcctgcggggccgccaggtccgccgtttccac
gtccagctcagcaaccctaagtttggggcccacctgggccagccccactccaccaccatc
atcatcagggacccagatgaactggaccggagcttcacgagtcagatgttgtcatcacag
ccaccccctcacggcgacctgggcgccccgcagaaccccaatgctaaggccgctgggtcc
aggaagatccatttcaactggctgcccccttctggcaagccaatggggtacagggtaaag
tactggattcagggtgactccgaatccgaagcccacctgctcgacagcaaggtgccctca
gtggagctcaccaacctgtacccgtattgcgactatgagatgaaggtgtgcgcctacggg
gctcagggcgagggaccctacagctccctggtgtcctgccgcacccaccaggaagtgccc
agcgagccagggcgtctggccttcaatgtcgtctcctccacggtgacccagctgagctgg
gctgagccggctgagaccaacggtgagatcacagcctacgaggtctgctatggcctggtc
aacgatgacaaccgacctattgggcccatgaagaaagtgctggttgacaaccctaagaac
cggatgctgcttattgagaaccttcgggagtcccagccctaccgctacacggtgaaggcg
cgcaacggggccggctgggggcctgagcgggaggccatcatcaacctggccacccagccc
aagaggcccatgtccatccccatcatccctgacatccctatcgtggacgcccagagcggg
gaggactacgacagcttccttatgtacagcgatgacgttctacgctctccatcgggcagc
cagaggcccagcgtctccgatgacactggctgcggctggaagttcgagcccctgctgggg
gaggagctggacctgcggcgcgtcacgtggcggctgcccccggagctcatcccgcgcctg
tcggccagcagcgggcgctcctccgacgccgaggcgccccacgggcccccggacgacggc
ggcgcgggcgggaagggcggcagcctgccccgcagtgcgacacccgggccccccggagag
cacctggtgaatggccggatggactttgccttcccgggcagcaccaactccctgcacagg
atgaccacgaccagtgctgctgcctatggcacccacctgagcccacacgtgccccaccgc
gtgctaagcacatcctccaccctcacacgggactacaactcactgacccgctcagaacac
tcacactcgaccacactgcccagggactactccaccctcacctccgtctcctcccacgac
tctcgcctgactgctggtgtgcccgacacgcccacccgcctggtgttctctgccctgggg
cccacatctctcagagtgagctggcaggagccgcggtgcgagcggccgctgcagggctac
agtgtggagtaccagctgctgaacggcggtgagctgcatcggctcaacatccccaaccct
gcccagacctcggtggtggtggaagacctcctgcccaaccactcctacgtgttccgcgtg
cgggcccagagccaggaaggctggggccgagagcgtgagggtgtcatcaccattgaatcc
caggtgcacccgcagagcccactgtgtcccctgccaggctccgccttcactttgagcact
cccagtgccccaggcccgctggtgttcactgccctgagcccagactcgctgcagctgagc
tgggagcggccacggaggcccaatggggatatcgtcggctacctggtgacctgtgagatg
gcccaaggaggagggccagccaccgcattccgggtggatggagacagccccgagagccgg
ctgaccgtgccgggcctcagcgagaacgtgccctacaagttcaaggtgcaggccaggacc
actgagggcttcgggccagagcgcgagggcatcatcaccatagagtcccaggatggagga
cccttcccgcagctgggcagccgtgccgggctcttccagcacccgctgcaaagcgagtac
agcagcatcaccaccacccacaccagcgccaccgagcccttcctagtggatgggctgacc
ctgggggcccagcacctggaggcaggcggctccctcacccggcatgtgacccaggagttt
gtgagccggacactgaccaccagcggaacccttagcacccacatggaccaacagttcttc
caaacttga

Protein Sequence

>3691 : length: 1822
MAGPRPSPWARLLLAALISVSLSGTLANRCKKAPVKSCTECVRVDKDCAYCTDEMFRDRR
CNTQAELLAAGCQRESIVVMESSFQITEETQIDTTLRRSQMSPQGLRVRLRPGEERHFEL
EVFEPLESPVDLYILMDFSNSMSDDLDNLKKMGQNLARVLSQLTSDYTIGFGKFVDKVSV
PQTDMRPEKLKEPWPNSDPPFSFKNVISLTEDVDEFRNKLQGERISGNLDAPEGGFDAIL
QTAVCTRDIGWRPDSTHLLVFSTESAFHYEADGANVLAGIMSRNDERCHLDTTGTYTQYR
TQDYPSVPTLVRLLAKHNIIPIFAVTNYSYSYYEKLHTYFPVSSLGVLQEDSSNIVELLE
EAFNRIRSNLDIRALDSPRGLRTEVTSKMFQKTRTGSFHIRRGEVGIYQVQLRALEHVDG
THVCQLPEDQKGNIHLKPSFSDGLKMDAGIICDVCTCELQKEVRSARCSFNGDFVCGQCV
CSEGWSGQTCNCSTGSLSDIQPCLREGEDKPCSGRGECQCGHCVCYGEGRYEGQFCEYDN
FQCPRTSGFLCNDRGRCSMGQCVCEPGWTGPSCDCPLSNATCIDSNGGICNGRGHCECGR
CHCHQQSLYTDTICEINYSAIHPGLCEDLRSCVQCQAWGTGEKKGRTCEECNFKVKMVDE
LKRAEEVVVRCSFRDEDDDCTYSYTMEGDGAPGPNSTVLVHKKKDCPPGSFWWLIPLLLL
LLPLLALLLLLCWKYCACCKACLALLPCCNRGHMVGFKEDHYMLRENLMASDHLDTPMLR
SGNLKGRDVVRWKVTNNMQRPGFATHAASINPTELVPYGLSLRLARLCTENLLKPDTREC
AQLRQEVEENLNEVYRQISGVHKLQQTKFRQQPNAGKKQDHTIVDTVLMAPRSAKPALLK
LTEKQVEQRAFHDLKVAPGYYTLTADQDARGMVEFQEGVELVDVRVPLFIRPEDDDEKQL
LVEAIDVPAGTATLGRRLVNITIIKEQARDVVSFEQPEFSVSRGDQVARIPVIRRVLDGG
KSQVSYRTQDGTAQGNRDYIPVEGELLFQPGEAWKELQVKLLELQEVDSLLRGRQVRRFH
VQLSNPKFGAHLGQPHSTTIIIRDPDELDRSFTSQMLSSQPPPHGDLGAPQNPNAKAAGS
RKIHFNWLPPSGKPMGYRVKYWIQGDSESEAHLLDSKVPSVELTNLYPYCDYEMKVCAYG
AQGEGPYSSLVSCRTHQEVPSEPGRLAFNVVSSTVTQLSWAEPAETNGEITAYEVCYGLV
NDDNRPIGPMKKVLVDNPKNRMLLIENLRESQPYRYTVKARNGAGWGPEREAIINLATQP
KRPMSIPIIPDIPIVDAQSGEDYDSFLMYSDDVLRSPSGSQRPSVSDDTGCGWKFEPLLG
EELDLRRVTWRLPPELIPRLSASSGRSSDAEAPHGPPDDGGAGGKGGSLPRSATPGPPGE
HLVNGRMDFAFPGSTNSLHRMTTTSAAAYGTHLSPHVPHRVLSTSSTLTRDYNSLTRSEH
SHSTTLPRDYSTLTSVSSHDSRLTAGVPDTPTRLVFSALGPTSLRVSWQEPRCERPLQGY
SVEYQLLNGGELHRLNIPNPAQTSVVVEDLLPNHSYVFRVRAQSQEGWGREREGVITIES
QVHPQSPLCPLPGSAFTLSTPSAPGPLVFTALSPDSLQLSWERPRRPNGDIVGYLVTCEM
AQGGGPATAFRVDGDSPESRLTVPGLSENVPYKFKVQARTTEGFGPEREGIITIESQDGG
PFPQLGSRAGLFQHPLQSEYSSITTTHTSATEPFLVDGLTLGAQHLEAGGSLTRHVTQEF
VSRTLTTSGTLSTHMDQQFFQT



')