Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3690

Name

ITGB3

Synonym

BDPLT2|CD61|GP3A|GPIIIa|GT;integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61);ITGB3;integrin, beta 3 (platelet glycoprotein IIIa, antigen CD61)

Definition

integrin beta-3|platelet glycoprotein IIIa|platelet membrane glycoprotein IIIa

Position

17q21.32

Gene Type

protein-coding

Pathways and Diseases

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Ephrin B reverse signaling;PID Curated;200173

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

IL4-mediated signaling events;PID Curated;200018

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

PECAM1 interactions;PID Reactome;500307

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Nectin adhesion pathway;PID Curated;200053

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

Blood coagulation;PANTHER;P00011

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

phospholipids as signalling intermediaries;PID BioCarta;100183

Pathway

Phagosome;KEGG PATHWAY;hsa04145

Pathway

Signaling events mediated by PTP1B;PID Curated;200033

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Arf6 signaling events;PID Curated;200060

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Disease

Lupus erythematosus;FunDO

Disease

Hematologic diseases;KEGG DISEASE

Disease

IMMUNE;GAD

Disease

premature myocardial infarction in men.;GAD

Disease

HEMATOLOGICAL;GAD

Disease

double homozygosity for receptor polymorphisms of platelet GPIa and GPIIIa;GAD

Disease

cardiovascular;GAD

Disease

kidney cancer;GAD

Disease

breast cancer;GAD

Disease

Asthma;FunDO

Disease

Cancer;FunDO

Disease

Purpura, Thrombocytopenic, Idiopathic;FunDO

Disease

allergy;GAD

Disease

Takayasu's arteritis;FunDO

Disease

fetal loss, early;GAD

Disease

hypertension;GAD

Disease

stroke, ischemic;GAD

Disease

Resistance in vitro to low-dose aspirin;GAD

Disease

Circulatory system diseases;KEGG DISEASE

Disease

Stroke;GAD

Disease

lung cancer;GAD

Disease

atherosclerosis, coronary;GAD

Disease

Thrombocytopenia;FunDO

Disease

cardiovascular disease;GAD

Disease

Subarachnoid hemorrhage;FunDO

Disease

Aplastic anemia;FunDO

Disease

Asthma;GAD

Disease

METABOLIC;GAD

Disease

aspirin resistance;GAD

Disease

Stroke;FunDO

Disease

cancer;GAD

Disease

Autistic disorder;FunDO

Disease

Intermediate coronary syndrome;FunDO

Disease

diabetes, type 2;GAD

Disease

PSYCH;GAD

Disease

Diabetes mellitus;FunDO

Disease

heart disease, ischemic;GAD

Disease

Penile disease;FunDO

Disease

Autism;GAD

Disease

CARDIOVASCULAR;GAD

Disease

asthma IgE wheezing;GAD

Disease

Kidney Failure, Chronic;GAD

Disease

Allograft rejection;KEGG DISEASE;H00083

Disease

CANCER;GAD

Disease

Myocardial Infarction;GAD

Disease

Hemorrhagic fevers, Viral;FunDO

Disease

Hemorrhagic disorder;FunDO

Disease

neonatal thrombocytopenia;GAD

Disease

REPRODUCTION;GAD

Disease

cancer.;GAD

Disease

lipoprotein;GAD

Disease

Glanzmann thrombasthenia, type B;OMIM

Disease

peripheral vascular disease;GAD

Disease

Increased platelet aggregability;GAD

Disease

Immune system diseases;KEGG DISEASE

Disease

Glanzmann thrombasthenia;KEGG DISEASE;H00226

Disease

fracture risk;GAD

Disease

Pemphigoid, Bullous;FunDO

Disease

Allergies and autoimmune diseases;KEGG DISEASE

Disease

Glanzmann thrombasthenia;GAD

Disease

breast cancer ovarian cancer;GAD

Disease

myocardial infarct;GAD

Disease

Temporal arteritis;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3690

Links to all GeneRIF Items

3690

Links to iHOP

3690

Sequence Information

Nucleotide Sequence

>3690 : length: 2367
atgcgagcgcggccgcggccccggccgctctgggcgactgtgctggcgctgggggcgctg
gcgggcgttggcgtaggagggcccaacatctgtaccacgcgaggtgtgagctcctgccag
cagtgcctggctgtgagccccatgtgtgcctggtgctctgatgaggccctgcctctgggc
tcacctcgctgtgacctgaaggagaatctgctgaaggataactgtgccccagaatccatc
gagttcccagtgagtgaggcccgagtactagaggacaggcccctcagcgacaagggctct
ggagacagctcccaggtcactcaagtcagtccccagaggattgcactccggctccggcca
gatgattcgaagaatttctccatccaagtgcggcaggtggaggattaccctgtggacatc
tactacttgatggacctgtcttactccatgaaggatgatctgtggagcatccagaacctg
ggtaccaagctggccacccagatgcgaaagctcaccagtaacctgcggattggcttcggg
gcatttgtggacaagcctgtgtcaccatacatgtatatctccccaccagaggccctcgaa
aacccctgctatgatatgaagaccacctgcttgcccatgtttggctacaaacacgtgctg
acgctaactgaccaggtgacccgcttcaatgaggaagtgaagaagcagagtgtgtcacgg
aaccgagatgccccagagggtggctttgatgccatcatgcaggctacagtctgtgatgaa
aagattggctggaggaatgatgcatcccacttgctggtgtttaccactgatgccaagact
catatagcattggacggaaggctggcaggcattgtccagcctaatgacgggcagtgtcat
gttggtagtgacaatcattactctgcctccactaccatggattatccctctttggggctg
atgactgagaagctatcccagaaaaacatcaatttgatctttgcagtgactgaaaatgta
gtcaatctctatcagaactatagtgagctcatcccagggaccacagttggggttctgtcc
atggattccagcaatgtcctccagctcattgttgatgcttatgggaaaatccgttctaaa
gtagagctggaagtgcgtgacctccctgaagagttgtctctatccttcaatgccacctgc
ctcaacaatgaggtcatccctggcctcaagtcttgtatgggactcaagattggagacacg
gtgagcttcagcattgaggccaaggtgcgaggctgtccccaggagaaggagaagtccttt
accataaagcccgtgggcttcaaggacagcctgatcgtccaggtcacctttgattgtgac
tgtgcctgccaggcccaagctgaacctaatagccatcgctgcaacaatggcaatgggacc
tttgagtgtggggtatgccgttgtgggcctggctggctgggatcccagtgtgagtgctca
gaggaggactatcgcccttcccagcaggacgaatgcagcccccgggagggtcagcccgtc
tgcagccagcggggcgagtgcctctgtggtcaatgtgtctgccacagcagtgactttggc
aagatcacgggcaagtactgcgagtgtgacgacttctcctgtgtccgctacaagggggag
atgtgctcaggccatggccagtgcagctgtggggactgcctgtgtgactccgactggacc
ggctactactgcaactgtaccacgcgtactgacacctgcatgtccagcaatgggctgctg
tgcagcggccgcggcaagtgtgaatgtggcagctgtgtctgtatccagccgggctcctat
ggggacacctgtgagaagtgccccacctgcccagatgcctgcacctttaagaaagaatgt
gtggagtgtaagaagtttgaccggggagccctacatgacgaaaatacctgcaaccgttac
tgccgtgacgagattgagtcagtgaaagagcttaaggacactggcaaggatgcagtgaat
tgtacctataagaatgaggatgactgtgtcgtcagattccagtactatgaagattctagt
ggaaagtccatcctgtatgtggtagaagagccagagtgtcccaagggccctgacatcctg
gtggtcctgctctcagtgatgggggccattctgctcattggccttgccgccctgctcatc
tggaaactcctcatcaccatccacgaccgaaaagaattcgctaaatttgaggaagaacgc
gccagagcaaaatgggacacagccaacaacccactgtataaagaggccacgtctaccttc
accaatatcacgtaccggggcacttaa

Protein Sequence

>3690 : length: 788
MRARPRPRPLWATVLALGALAGVGVGGPNICTTRGVSSCQQCLAVSPMCAWCSDEALPLG
SPRCDLKENLLKDNCAPESIEFPVSEARVLEDRPLSDKGSGDSSQVTQVSPQRIALRLRP
DDSKNFSIQVRQVEDYPVDIYYLMDLSYSMKDDLWSIQNLGTKLATQMRKLTSNLRIGFG
AFVDKPVSPYMYISPPEALENPCYDMKTTCLPMFGYKHVLTLTDQVTRFNEEVKKQSVSR
NRDAPEGGFDAIMQATVCDEKIGWRNDASHLLVFTTDAKTHIALDGRLAGIVQPNDGQCH
VGSDNHYSASTTMDYPSLGLMTEKLSQKNINLIFAVTENVVNLYQNYSELIPGTTVGVLS
MDSSNVLQLIVDAYGKIRSKVELEVRDLPEELSLSFNATCLNNEVIPGLKSCMGLKIGDT
VSFSIEAKVRGCPQEKEKSFTIKPVGFKDSLIVQVTFDCDCACQAQAEPNSHRCNNGNGT
FECGVCRCGPGWLGSQCECSEEDYRPSQQDECSPREGQPVCSQRGECLCGQCVCHSSDFG
KITGKYCECDDFSCVRYKGEMCSGHGQCSCGDCLCDSDWTGYYCNCTTRTDTCMSSNGLL
CSGRGKCECGSCVCIQPGSYGDTCEKCPTCPDACTFKKECVECKKFDRGALHDENTCNRY
CRDEIESVKELKDTGKDAVNCTYKNEDDCVVRFQYYEDSSGKSILYVVEEPECPKGPDIL
VVLLSVMGAILLIGLAALLIWKLLITIHDRKEFAKFEEERARAKWDTANNPLYKEATSTF
TNITYRGT



')