Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3688

Name

ITGB1

Synonym

CD29|FNRB|GPIIA|MDF2|MSK12|VLA-BETA|VLAB;integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12);ITGB1;integrin, beta 1 (fibronectin receptor, beta polypeptide, antigen CD29 includes MDF2, MSK12)

Definition

integrin VLA-4 beta subunit|integrin beta-1|very late activation protein, beta polypeptide

Position

10p11.2

Gene Type

protein-coding

Pathways and Diseases

Pathway

agrin in postsynaptic differentiation;PID BioCarta;100252

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

Signaling events mediated by TCPTP;PID Curated;200065

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

Regulation of actin cytoskeleton;KEGG PATHWAY;hsa04810

Pathway

Cell surface interactions at the vascular wall;PID Reactome;500305

Pathway

Cell adhesion molecules (CAMs);KEGG PATHWAY;hsa04514

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

VEGFR3 signaling in lymphatic endothelium;PID Curated;200188

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Signaling events mediated by PRL;PID Curated;200006

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

a6b1 and a6b4 Integrin signaling;PID Curated;200162

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Paxillin-independent events mediated by a4b1 and a4b7;PID Curated;200178

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

Collagen adhesion via alpha 2 beta 1 glycoprotein;PID Reactome;501010

Pathway

Axon guidance;KEGG PATHWAY;hsa04360

Pathway

Reelin signaling pathway;PID Curated;200051

Pathway

Shigellosis;KEGG PATHWAY;hsa05131

Pathway

Hypertrophic cardiomyopathy (HCM);KEGG PATHWAY;hsa05410

Pathway

Leukocyte transendothelial migration;KEGG PATHWAY;hsa04670

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Signaling events mediated by focal adhesion kinase;PID Curated;200192

Pathway

Pathogenic Escherichia coli infection;KEGG PATHWAY;hsa05130

Pathway

Arrhythmogenic right ventricular cardiomyopathy (ARVC);KEGG PATHWAY;hsa05412

Pathway

ucalpain and friends in cell spread;PID BioCarta;100008

Pathway

Paxillin-dependent events mediated by a4b1;PID Curated;200117

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Phagosome;KEGG PATHWAY;hsa04145

Pathway

Other semaphorin interactions;PID Reactome;500078

Pathway

Angiopoietin receptor Tie2-mediated signaling;PID Curated;200066

Pathway

Hemostasis;Reactome;REACT:604

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

erk and pi-3 kinase are necessary for collagen binding in corneal epithelia;PID BioCarta;100184

Pathway

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell;PID Reactome;500477

Pathway

a4b1 and a4b7 Integrin signaling;PID Curated;200092

Pathway

integrin signaling pathway;PID BioCarta;100123

Pathway

Localization of the PINCH-ILK-PARVIN complex to focal adhesions;PID Reactome;500124

Pathway

mcalpain and friends in cell motility;PID BioCarta;100111

Pathway

Dilated cardiomyopathy;KEGG PATHWAY;hsa05414

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Pathway

Syndecan-2-mediated signaling events;PID Curated;200164

Disease

Drug abuse;FunDO

Disease

Lupus erythematosus;FunDO

Disease

Pleural effusion, Malignant;FunDO

Disease

Shigella infection;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Alopecia;FunDO

Disease

Primary hyperparathyroidism;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

Thalassemia;FunDO

Disease

Pemphigoid, Bullous;FunDO

Disease

Cancer;FunDO

Disease

Purpura, Thrombocytopenic, Idiopathic;FunDO

Disease

Systemic infection;FunDO

Disease

Sickle cell disease;FunDO

Disease

Depression;FunDO

Disease

Depression--quantitative trait;NHGRI

Disease

Aortic aneurysm;FunDO

External Links

Links to Entrez Gene

3688

Links to all GeneRIF Items

3688

Links to iHOP

3688

Sequence Information

Nucleotide Sequence

>3688 : length: 2397
atgaatttacaaccaattttctggattggactgatcagttcagtttgctgtgtgtttgct
caaacagatgaaaatagatgtttaaaagcaaatgccaaatcatgtggagaatgtatacaa
gcagggccaaattgtgggtggtgcacaaattcaacatttttacaggaaggaatgcctact
tctgcacgatgtgatgatttagaagccttaaaaaagaagggttgccctccagatgacata
gaaaatcccagaggctccaaagatataaagaaaaataaaaatgtaaccaaccgtagcaaa
ggaacagcagagaagctcaagccagaggatattactcagatccaaccacagcagttggtt
ttgcgattaagatcaggggagccacagacatttacattaaaattcaagagagctgaagac
tatcccattgacctctactaccttatggacctgtcttactcaatgaaagacgatttggag
aatgtaaaaagtcttggaacagatctgatgaatgaaatgaggaggattacttcggacttc
agaattggatttggctcatttgtggaaaagactgtgatgccttacattagcacaacacca
gctaagctcaggaacccttgcacaagtgaacagaactgcaccagcccatttagctacaaa
aatgtgctcagtcttactaataaaggagaagtatttaatgaacttgttggaaaacagcgc
atatctggaaatttggattctccagaaggtggtttcgatgccatcatgcaagttgcagtt
tgtggatcactgattggctggaggaatgttacacggctgctggtgttttccacagatgcc
gggtttcactttgctggagatgggaaacttggtggcattgttttaccaaatgatggacaa
tgtcacctggaaaataatatgtacacaatgagccattattatgattatccttctattgct
caccttgtccagaaactgagtgaaaataatattcagacaatttttgcagttactgaagaa
tttcagcctgtttacaaggagctgaaaaacttgatccctaagtcagcagtaggaacatta
tctgcaaattctagcaatgtaattcagttgatcattgatgcatacaattccctttcctca
gaagtcattttggaaaacggcaaattgtcagaaggcgtaacaataagttacaaatcttac
tgcaagaacggggtgaatggaacaggggaaaatggaagaaaatgttccaatatttccatt
ggagatgaggttcaatttgaaattagcataacttcaaataagtgtccaaaaaaggattct
gacagctttaaaattaggcctctgggctttacggaggaagtagaggttattcttcagtac
atctgtgaatgtgaatgccaaagcgaaggcatccctgaaagtcccaagtgtcatgaagga
aatgggacatttgagtgtggcgcgtgcaggtgcaatgaagggcgtgttggtagacattgt
gaatgcagcacagatgaagttaacagtgaagacatggatgcttactgcaggaaagaaaac
agttcagaaatctgcagtaacaatggagagtgcgtctgcggacagtgtgtttgtaggaag
agggataatacaaatgaaatttattctggcaaattctgcgagtgtgataatttcaactgt
gatagatccaatggcttaatttgtggaggaaatggtgtttgcaagtgtcgtgtgtgtgag
tgcaaccccaactacactggcagtgcatgtgactgttctttggatactagtacttgtgaa
gccagcaacggacagatctgcaatggccggggcatctgcgagtgtggtgtctgtaagtgt
acagatccgaagtttcaagggcaaacgtgtgagatgtgtcagacctgccttggtgtctgt
gctgagcataaagaatgtgttcagtgcagagccttcaataaaggagaaaagaaagacaca
tgcacacaggaatgttcctattttaacattaccaaggtagaaagtcgggacaaattaccc
cagccggtccaacctgatcctgtgtcccattgtaaggagaaggatgttgacgactgttgg
ttctattttacgtattcagtgaatgggaacaacgaggtcatggttcatgttgtggagaat
ccagagtgtcccactggtccagacatcattccaattgtagctggtgtggttgctggaatt
gttcttattggccttgcattactgctgatatggaagcttttaatgataattcatgacaga
agggagtttgctaaatttgaaaaggagaaaatgaatgccaaatgggacacgggtgaaaat
cctatttataagagtgccgtaacaactgtggtcaatccgaagtatgagggaaaatga

Protein Sequence

>3688 : length: 798
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPT
SARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLV
LRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDF
RIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQR
ISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQ
CHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTL
SANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISI
GDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEG
NGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRK
RDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCE
ASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDT
CTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVEN
PECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGEN
PIYKSAVTTVVNPKYEGK



')