Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

367

Name

AR

Synonym

AIS|DHTR|HUMARA|HYSP1|KD|NR3C4|SBMA|SMAX1|TFM;androgen receptor;AR;androgen receptor

Definition

androgen nuclear receptor variant 2|dihydrotestosterone receptor|nuclear receptor subfamily 3 group C member 4

Position

Xq12

Gene Type

protein-coding

Pathways and Diseases

Pathway

FOXA1 transcription factor network;PID Curated;200194

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

Regulation of nuclear SMAD2/3 signaling;PID Curated;200002

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

Nongenotropic Androgen signaling;PID Curated;200145

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

Coregulation of Androgen receptor activity;PID Curated;200038

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Gene Expression;Reactome;REACT:71

Disease

osteoporotic fractures;GAD

Disease

cognitive function in older men;GAD

Disease

Cancer;FunDO

Disease

Hypospadias 1, X-linked;OMIM

Disease

Cholelithiasis;FunDO

Disease

azoospermia oligospermia;GAD

Disease

Depression;FunDO

Disease

IMMUNE;GAD

Disease

PSYCH;GAD

Disease

isolated penile hypospadias;GAD

Disease

Phobic anxiety disorder;FunDO

Disease

bone mass;GAD

Disease

uterine endometrial carcinoma;GAD

Disease

reduced trans-activation impaired sperm production and male infertility;GAD

Disease

Osteoporosis;GAD

Disease

Hypogonadism;FunDO

Disease

Infertility;FunDO

Disease

male-pattern baldness;GAD

Disease

Prostate cancer, susceptibility to;OMIM

Disease

Atherosclerosis;FunDO

Disease

Migraine;FunDO

Disease

Azoospermia;FunDO

Disease

violent criminal behavior;GAD

Disease

Androgen insensitivity;OMIM

Disease

DEVELOPMENTAL;GAD

Disease

ADHD and conduct disorder;GAD

Disease

prostate cancer;GAD

Disease

clinical parameters and endocrine status in elderly men;GAD

Disease

memory performance;GAD

Disease

Male-pattern baldness;NHGRI

Disease

Urogenital abnormalities;FunDO

Disease

hereditary and sporadic prostate cancer risk.;GAD

Disease

androgen insensitivity syndrome;GAD

Disease

NORMALVARIATION;GAD

Disease

body mass;GAD

Disease

male pattern baldness;GAD

Disease

Cancers of the urinary system and male genital organs;KEGG DISEASE

Disease

Osteoporosis;FunDO

Disease

endometrial cancer;GAD

Disease

semen PSA levels in adolescence.;GAD

Disease

LDL cholesterol;GAD

Disease

LDL cholesterol;NHGRI

Disease

AGING;GAD

Disease

Infertility, Male;GAD

Disease

Prostate cancer;FunDO

Disease

Phenotypic heterogeneity;GAD

Disease

osteoarthritis;GAD

Disease

METABOLIC;GAD

Disease

Schizophrenia;FunDO

Disease

retinopathy, diabetic;GAD

Disease

diabetes, type 2;GAD

Disease

Coronary Artery Disease;GAD

Disease

CARDIOVASCULAR;GAD

Disease

complete androgen insensitivity;GAD

Disease

hypospadias;GAD

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

urolithiasis;GAD

Disease

Oligospermia;FunDO

Disease

breast cancer;GAD

Disease

prostate enlargement;GAD

Disease

breast cancer, male;GAD

Disease

Nervous system diseases;KEGG DISEASE

Disease

obesity;GAD

Disease

Kennedy's disease;KEGG DISEASE;H00062

Disease

complete androgen insensitivity syndrome and Sertoli cell adenoma;GAD

Disease

Amyotrophic lateral sclerosis;FunDO

Disease

nephropathy in other diseases;GAD

Disease

Rheumatoid arthritis;FunDO

Disease

prostate specific antigen;GAD

Disease

Infertility, Male;FunDO

Disease

Yersinia infection;FunDO

Disease

bone density;GAD

Disease

Diabetes mellitus;FunDO

Disease

androgen levels;GAD

Disease

CANCER;GAD

Disease

Rabies;FunDO

Disease

Endometriosis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Androgen insensitivity, partial, with or without breast cancer;OMIM

Disease

memory impairment;GAD

Disease

Muscular atrophy;FunDO

Disease

Acne Vulgaris;GAD

Disease

Prostate cancer;KEGG DISEASE;H00024

Disease

Neurodegenerative diseases;KEGG DISEASE

Disease

Spinal and bulbar muscular atrophy of Kennedy;OMIM

External Links

Links to Entrez Gene

367

Links to all GeneRIF Items

367

Links to iHOP

367

Sequence Information

Nucleotide Sequence

>367 : length: 2763
atggaagtgcagttagggctgggaagggtctaccctcggccgccgtccaagacctaccga
ggagctttccagaatctgttccagagcgtgcgcgaagtgatccagaacccgggccccagg
cacccagaggccgcgagcgcagcacctcccggcgccagtttgctgctgctgcagcagcag
cagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcagcaa
gagactagccccaggcagcagcagcagcagcagggtgaggatggttctccccaagcccat
cgtagaggccccacaggctacctggtcctggatgaggaacagcaaccttcacagccgcag
tcggccctggagtgccaccccgagagaggttgcgtcccagagcctggagccgccgtggcc
gccagcaaggggctgccgcagcagctgccagcacctccggacgaggatgactcagctgcc
ccatccacgttgtccctgctgggccccactttccccggcttaagcagctgctccgctgac
cttaaagacatcctgagcgaggccagcaccatgcaactccttcagcaacagcagcaggaa
gcagtatccgaaggcagcagcagcgggagagcgagggaggcctcgggggctcccacttcc
tccaaggacaattacttagggggcacttcgaccatttctgacaacgccaaggagttgtgt
aaggcagtgtcggtgtccatgggcctgggtgtggaggcgttggagcatctgagtccaggg
gaacagcttcggggggattgcatgtacgccccacttttgggagttccacccgctgtgcgt
cccactccttgtgccccattggccgaatgcaaaggttctctgctagacgacagcgcaggc
aagagcactgaagatactgctgagtattcccctttcaagggaggttacaccaaagggcta
gaaggcgagagcctaggctgctctggcagcgctgcagcagggagctccgggacacttgaa
ctgccgtctaccctgtctctctacaagtccggagcactggacgaggcagctgcgtaccag
agtcgcgactactacaactttccactggctctggccggaccgccgccccctccgccgcct
ccccatccccacgctcgcatcaagctggagaacccgctggactacggcagcgcctgggcg
gctgcggcggcgcagtgccgctatggggacctggcgagcctgcatggcgcgggtgcagcg
ggacccggttctgggtcaccctcagccgccgcttcctcatcctggcacactctcttcaca
gccgaagaaggccagttgtatggaccgtgtggtggtggtgggggtggtggcggcggcggc
ggcggcggcggcggcggcggcggcggcggcggcggcggcgaggcgggagctgtagccccc
tacggctacactcggccccctcaggggctggcgggccaggaaagcgacttcaccgcacct
gatgtgtggtaccctggcggcatggtgagcagagtgccctatcccagtcccacttgtgtc
aaaagcgaaatgggcccctggatggatagctactccggaccttacggggacatgcgtttg
gagactgccagggaccatgttttgcccattgactattactttccaccccagaagacctgc
ctgatctgtggagatgaagcttctgggtgtcactatggagctctcacatgtggaagctgc
aaggtcttcttcaaaagagccgctgaagggaaacagaagtacctgtgcgccagcagaaat
gattgcactattgataaattccgaaggaaaaattgtccatcttgtcgtcttcggaaatgt
tatgaagcagggatgactctgggagcccggaagctgaagaaacttggtaatctgaaacta
caggaggaaggagaggcttccagcaccaccagccccactgaggagacaacccagaagctg
acagtgtcacacattgaaggctatgaatgtcagcccatctttctgaatgtcctggaagcc
attgagccaggtgtagtgtgtgctggacacgacaacaaccagcccgactcctttgcagcc
ttgctctctagcctcaatgaactgggagagagacagcttgtacacgtggtcaagtgggcc
aaggccttgcctggcttccgcaacttacacgtggacgaccagatggctgtcattcagtac
tcctggatggggctcatggtgtttgccatgggctggcgatccttcaccaatgtcaactcc
aggatgctctacttcgcccctgatctggttttcaatgagtaccgcatgcacaagtcccgg
atgtacagccagtgtgtccgaatgaggcacctctctcaagagtttggatggctccaaatc
accccccaggaattcctgtgcatgaaagcactgctactcttcagcattattccagtggat
gggctgaaaaatcaaaaattctttgatgaacttcgaatgaactacatcaaggaactcgat
cgtatcattgcatgcaaaagaaaaaatcccacatcctgctcaagacgcttctaccagctc
accaagctcctggactccgtgcagcctattgcgagagagctgcatcagttcacttttgac
ctgctaatcaagtcacacatggtgagcgtggactttccggaaatgatggcagagatcatc
tctgtgcaagtgcccaagatcctttctgggaaagtcaagcccatctatttccacacccag
tga

Protein Sequence

>367 : length: 920
MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQ
QQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQ
SALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSAD
LKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELC
KAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAG
KSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQ
SRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAA
GPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAP
YGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRL
ETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRN
DCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKL
TVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWA
KALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSR
MYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELD
RIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEII
SVQVPKILSGKVKPIYFHTQ



')