Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3611

Name

ILK

Synonym

ILK-2|P59;integrin-linked kinase;ILK;integrin-linked kinase

Definition

59 kDa serine/threonine-protein kinase|ILK-1|integrin-linked kinase-2|integrin-linked protein kinase|p59ILK

Position

11p15.4

Gene Type

protein-coding

Pathways and Diseases

Pathway

Bacterial invasion of epithelial cells;KEGG PATHWAY;hsa05100

Pathway

Cell junction organization;Reactome;REACT:20676

Pathway

pten dependent cell cycle arrest and apoptosis;PID BioCarta;100058

Pathway

Cell-extracellular matrix interactions;PID Reactome;500123

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Endometrial cancer;KEGG PATHWAY;hsa05213

Pathway

Osteopontin-mediated events;PID Curated;200042

Pathway

Localization of the PINCH-ILK-PARVIN complex to focal adhesions;PID Reactome;500124

Pathway

Integrin signalling pathway;PANTHER;P00034

Pathway

PPAR signaling pathway;KEGG PATHWAY;hsa03320

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

3611

Links to all GeneRIF Items

3611

Links to iHOP

3611

Sequence Information

Nucleotide Sequence

>3611 : length: 1359
atggacgacattttcactcagtgccgggagggcaacgcagtcgccgttcgcctgtggctg
gacaacacggagaacgacctcaaccagggggacgatcatggcttctcccccttgcactgg
gcctgccgagagggccgctctgctgtggttgagatgttgatcatgcggggggcacggatc
aatgtaatgaaccgtggggatgacacccccctgcatctggcagccagtcatggacaccgt
gatattgtacagaagctattgcagtacaaggcagacatcaatgcagtgaatgaacacggg
aatgtgcccctgcactatgcctgtttttggggccaagatcaagtggcagaggacctggtg
gcaaatggggcccttgtcagcatctgtaacaagtatggagagatgcctgtggacaaagcc
aaggcacccctgagagagcttctccgagagcgggcagagaagatgggccagaatctcaac
cgtattccatacaaggacacattctggaaggggaccacccgcactcggccccgaaatgga
accctgaacaaacactctggcattgacttcaaacagcttaacttcctgacgaagctcaac
gagaatcactctggagagctatggaagggccgctggcagggcaatgacattgtcgtgaag
gtgctgaaggttcgagactggagtacaaggaagagcagggacttcaatgaagagtgtccc
cggctcaggattttctcgcatccaaatgtgctcccagtgctaggtgcctgccagtctcca
cctgctcctcatcctactctcatcacacactggatgccgtatggatccctctacaatgta
ctacatgaaggcaccaatttcgtcgtggaccagagccaggctgtgaagtttgctttggac
atggcaaggggcatggccttcctacacacactagagcccctcatcccacgacatgcactc
aatagccgtagtgtaatgattgatgaggacatgactgcccgaattagcatggctgatgtc
aagttctctttccaatgtcctggtcgcatgtatgcacctgcctgggtagcccccgaagct
ctgcagaagaagcctgaagacacaaacagacgctcagcagacatgtggagttttgcagtg
cttctgtgggaactggtgacacgggaggtaccctttgctgacctctccaatatggagatt
ggaatgaaggtggcattggaaggccttcggcctaccatcccaccaggtatttcccctcat
gtgtgtaagctcatgaagatctgcatgaatgaagaccctgcaaagcgacccaaatttgac
atgattgtgcctatccttgagaagatgcaggacaagtag

Protein Sequence

>3611 : length: 452
MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARI
NVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLV
ANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNG
TLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECP
RLRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALD
MARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQCPGRMYAPAWVAPEA
LQKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPH
VCKLMKICMNEDPAKRPKFDMIVPILEKMQDK



')