Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3606

Name

IL18

Synonym

IGIF|IL-18|IL-1g|IL1F4;interleukin 18 (interferon-gamma-inducing factor);IL18;interleukin 18 (interferon-gamma-inducing factor)

Definition

IFN-gamma-inducing factor|IL-1 gamma|iboctadekin|interleukin-1 gamma|interleukin-18

Position

11q22.2-q22.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

ras-independent pathway in nk cell-mediated cytotoxicity;PID BioCarta;100095

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

IL12 signaling mediated by STAT4;PID Curated;200197

Pathway

Cellular roles of Anthrax toxin;PID Curated;200179

Pathway

Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623

Pathway

Interleukin signaling pathway;PANTHER;P00036

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Toll receptor signaling pathway;PANTHER;P00054

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Disease

CANCER;GAD

Disease

Lupus erythematosus;FunDO

Disease

atopy;GAD

Disease

allergic rhinitis;GAD

Disease

asthma atopy;GAD

Disease

Alzheimer's disease;GAD

Disease

Hepatitis B, Chronic;GAD

Disease

bone marrow transplantation;GAD

Disease

dermatitis and eczema;GAD

Disease

Melanoma;FunDO

Disease

Hepatitis C;FunDO

Disease

asthma.;GAD

Disease

Intermediate coronary syndrome;FunDO

Disease

Oral cancer;FunDO

Disease

Sickle cell disease;FunDO

Disease

Helicobacter infection;FunDO

Disease

rhinitis;GAD

Disease

Embryoma;FunDO

Disease

Dermatitis;FunDO

Disease

Prostate cancer;FunDO

Disease

Cystic fibrosis;FunDO

Disease

IMMUNE;GAD

Disease

Infection;FunDO

Disease

rheumatoid arthritis;GAD

Disease

atopic dermatitis;GAD

Disease

Leukemia;FunDO

Disease

protein quantitative trait loci;GAD

Disease

Liver disease;FunDO

Disease

Systemic infection;FunDO

Disease

Dental plaque;FunDO

Disease

lung cancer;GAD

Disease

Stroke;FunDO

Disease

Asthma;GAD

Disease

INFECTION;GAD

Disease

Alzheimer's disease;FunDO

Disease

Nephrosis;FunDO

Disease

Liver failure;FunDO

Disease

sepsis;GAD

Disease

hepatocellular carcinoma;GAD

Disease

diabetes, type 1;GAD

Disease

ulcerative colitis;GAD

Disease

IL18 expression level;GAD

Disease

latex allergy;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Protein quantitative trait loci;NHGRI

Disease

Multiple sclerosis;FunDO

Disease

Sarcoidosis;FunDO

Disease

Familial Mediterranean fever;FunDO

Disease

Heart failure;FunDO

Disease

Crohn's disease;GAD

Disease

collagen disease juvenile arthritis rheumatoid arthritis Still's disease;GAD

Disease

Endometriosis;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

NEUROLOGICAL;GAD

Disease

Schizophrenia;FunDO

Disease

Alimentary system disease;FunDO

Disease

Cerebral palsy;FunDO

Disease

Behcet syndrome;FunDO

Disease

IL-18 lupus erythematosus;GAD

Disease

Enteritis;FunDO

Disease

body mass coronary artery bypass graft;GAD

Disease

Skin disease;FunDO

Disease

Ovarian cancer;FunDO

Disease

Lymphoma;FunDO

Disease

Obesity;FunDO

Disease

IL-18 concentration physical functioning;GAD

Disease

Still's disease;GAD

Disease

hepatitis B;GAD

Disease

Neoplasm metastasis;FunDO

Disease

ovarian cancer;GAD

Disease

anti-GAD65 antibody;GAD

Disease

Asthma;FunDO

Disease

Arthritis;FunDO

Disease

Mucocutaneous Lymph Node Syndrome;GAD

Disease

Cushing syndrome;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3606

Links to all GeneRIF Items

3606

Links to iHOP

3606

Sequence Information

Nucleotide Sequence

>3606 : length: 582
atggctgctgaaccagtagaagacaattgcatcaactttgtggcaatgaaatttattgac
aatacgctttactttatagctgaagatgatgaaaacctggaatcagattactttggcaag
cttgaatctaaattatcagtcataagaaatttgaatgaccaagttctcttcattgaccaa
ggaaatcggcctctatttgaagatatgactgattctgactgtagagataatgcaccccgg
accatatttattataagtatgtataaagatagccagcctagaggtatggctgtaactatc
tctgtgaagtgtgagaaaatttcaactctctcctgtgagaacaaaattatttcctttaag
gaaatgaatcctcctgataacatcaaggatacaaaaagtgacatcatattctttcagaga
agtgtcccaggacatgataataagatgcaatttgaatcttcatcatacgaaggatacttt
ctagcttgtgaaaaagagagagacctttttaaactcattttgaaaaaagaggatgaattg
ggggatagatctataatgttcactgttcaaaacgaagactag

Protein Sequence

>3606 : length: 193
MAAEPVEDNCINFVAMKFIDNTLYFIAEDDENLESDYFGKLESKLSVIRNLNDQVLFIDQ
GNRPLFEDMTDSDCRDNAPRTIFIISMYKDSQPRGMAVTISVKCEKISTLSCENKIISFK
EMNPPDNIKDTKSDIIFFQRSVPGHDNKMQFESSSYEGYFLACEKERDLFKLILKKEDEL
GDRSIMFTVQNED



')