Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3570

Name

IL6R

Synonym

CD126|IL-6R-1|IL-6RA|IL6RA|gp80;interleukin 6 receptor;IL6R;interleukin 6 receptor

Definition

CD126 antigen|IL-6 receptor subunit alpha|IL-6R 1|interleukin-6 receptor subunit alpha|membrane glycoprotein 80

Position

1q21

Gene Type

protein-coding

Pathways and Diseases

Pathway

Jak-STAT signaling pathway;KEGG PATHWAY;hsa04630

Pathway

role of erbb2 in signal transduction and oncology;PID BioCarta;100147

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

il 6 signaling pathway;PID BioCarta;100126

Pathway

IL6-mediated signaling events;PID Curated;200124

Pathway

Interleukin signaling pathway;PANTHER;P00036

Disease

HEMATOLOGICAL;GAD

Disease

Pulmonary function traits (other);NHGRI

Disease

obesity;GAD

Disease

Liver cancer;FunDO

Disease

Neoplasm metastasis;FunDO

Disease

IMMUNE;GAD

Disease

Multiple myeloma;FunDO

Disease

protein quantitative trait loci;GAD

Disease

METABOLIC;GAD

Disease

Pancreas cancer;FunDO

Disease

Hyperparathyroidism;FunDO

Disease

glucose tolerance;GAD

Disease

Autoimmune disease;FunDO

Disease

diabetes, type 2;GAD

Disease

HTLV-I infection;FunDO

Disease

Celiac Disease;GAD

Disease

CARDIOVASCULAR;GAD

Disease

Protein quantitative trait loci;NHGRI

Disease

Stroke;FunDO

Disease

pulmonary function traits (other);GAD

Disease

Fibrinogen;NHGRI

Disease

Endometriosis;FunDO

Disease

Hypertension;FunDO

Disease

Liver tumor;FunDO

Disease

C-reactive protein;GAD

Disease

C-reactive protein;NHGRI

Disease

Kidney tubular necrosis, acute;FunDO

Disease

Infertility;FunDO

Disease

body mass metabolic syndrome;GAD

Disease

fibrinogen;GAD

Disease

Hyperandrogenism;GAD

External Links

Links to Entrez Gene

3570

Links to all GeneRIF Items

3570

Links to iHOP

3570

Sequence Information

Nucleotide Sequence

>3570 : length: 1407
atgctggccgtcggctgcgcgctgctggctgccctgctggccgcgccgggagcggcgctg
gccccaaggcgctgccctgcgcaggaggtggcgagaggcgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccgggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccaccccagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccacgactctggaaactattcatgctaccgggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaatgttgtttgtgagtggggtcctcggagcacccca
tccctgacgacaaaggctgtgctcttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcccaggagtcccagaagttctcctgccagttagcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgtcgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacgccttggacagaatccaggagt
cctccagctgagaacgaggtgtccacccccatgcaggcacttactactaataaagacgat
gataatattctcttcagagattctgcaaatgcgacaagcctcccagtgcaagattcttct
tcagtaccactgcccacattcctggttgctggagggagcctggccttcggaacgctcctc
tgcattgccattgttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggc
aagacaagcatgcatccgccgtactctttggggcagctggtcccggagaggcctcgaccc
accccagtgcttgttcctctcatctccccaccggtgtcccccagcagcctggggtctgac
aatacctcgagccacaaccgaccagatgccagggacccacggagcccttatgacatcagc
aatacagactacttcttccccagatag

Protein Sequence

>3570 : length: 468
MLAVGCALLAALLAAPGAALAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSS
SVPLPTFLVAGGSLAFGTLLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPERPRP
TPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDYFFPR



')