Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3553

Name

IL1B

Synonym

IL-1|IL1-BETA|IL1F2;interleukin 1, beta;IL1B;interleukin 1, beta

Definition

IL-1 beta|catabolin|interleukin-1 beta|preinterleukin 1 beta|pro-interleukin-1-beta

Position

2q14

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling in Immune system;Reactome;REACT:6900

Pathway

nfkb activation by nontypeable hemophilus influenzae;PID BioCarta;100088

Pathway

Cytokine-cytokine receptor interaction;KEGG PATHWAY;hsa04060

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

Type I diabetes mellitus;KEGG PATHWAY;hsa04940

Pathway

Alzheimer's disease;KEGG PATHWAY;hsa05010

Pathway

IL12-mediated signaling events;PID Curated;200034

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

IL27-mediated signaling events;PID Curated;200023

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Hematopoietic cell lineage;KEGG PATHWAY;hsa04640

Pathway

Cytosolic DNA-sensing pathway;KEGG PATHWAY;hsa04623

Pathway

IFN-gamma pathway;PID Curated;200110

Pathway

Malaria;KEGG PATHWAY;hsa05144

Pathway

signal transduction through il1r;PID BioCarta;100132

Pathway

Graft-versus-host disease;KEGG PATHWAY;hsa05332

Pathway

Cellular roles of Anthrax toxin;PID Curated;200179

Pathway

IL1-mediated signaling events;PID Curated;200075

Pathway

Chagas disease;KEGG PATHWAY;hsa05142

Pathway

Prion diseases;KEGG PATHWAY;hsa05020

Pathway

Toll-like receptor signaling pathway;KEGG PATHWAY;hsa04620

Pathway

IL23-mediated signaling events;PID Curated;200131

Pathway

Interleukin-1 signaling;PID Reactome;500490

Pathway

Leishmaniasis;KEGG PATHWAY;hsa05140

Disease

Coronary Restenosis;GAD

Disease

atopy;GAD

Disease

inflammatory bowel disease;GAD

Disease

Premature birth;FunDO

Disease

gastric carcinoma;GAD

Disease

Helicobacter pylori infection;GAD

Disease

Psoriasis;FunDO

Disease

Respiratory distress syndrome;FunDO

Disease

Henoch-Schoenlein purpura;FunDO

Disease

Glaucoma;FunDO

Disease

Alveolar bone loss;FunDO

Disease

IMMUNE;GAD

Disease

Multiple myeloma;FunDO

Disease

INFECTION;GAD

Disease

Cervical cancer;FunDO

Disease

Asthma in men;GAD

Disease

PSYCH;GAD

Disease

Bronchopulmonary dysplasia;FunDO

Disease

Stroke;FunDO

Disease

Graves' disease;FunDO

Disease

Hypertension;FunDO

Disease

multiple sclerosis;GAD

Disease

Infectious lung disease;FunDO

Disease

Synovial sarcoma;FunDO

Disease

Infertility;FunDO

Disease

Atherosclerosis;FunDO

Disease

Lupus erythematosus;FunDO

Disease

lymphoma;GAD

Disease

Oral cancer;FunDO

Disease

Lung cancer;FunDO

Disease

Stomach Neoplasms;GAD

Disease

Melanoma;FunDO

Disease

recurrent pregnancy loss;GAD

Disease

Ulcerative colitis;FunDO

Disease

Helicobacter infection;FunDO

Disease

nephropathy, IgA;GAD

Disease

rhinitis;GAD

Disease

Retinoblastoma;FunDO

Disease

Dermatitis;FunDO

Disease

Amnionitis;FunDO

Disease

bullous pemphigoid;GAD

Disease

sclerosis, systemic;GAD

Disease

gingival bleeding gingivitis;GAD

Disease

Otitis media;FunDO

Disease

Alzheimer's Disease and Vascular Dementia;GAD

Disease

Drug abuse;FunDO

Disease

Gastric cancer risk after H. pylori infection;OMIM

Disease

Crohn's disease;GAD

Disease

Helicobacter Infections;GAD

Disease

chronic atrophic gastritis and gastric carcinoma;GAD

Disease

Bipolar disorder;FunDO

Disease

Behcet syndrome;FunDO

Disease

Shigella infection;FunDO

Disease

Esophagitis;FunDO

Disease

Ovarian cancer;FunDO

Disease

diabetic nephropathy;GAD

Disease

Bacterial vaginosis;FunDO

Disease

Gastritis;GAD

Disease

ulcerative colitis;GAD

Disease

Arthritis;FunDO

Disease

Sicca syndrome;FunDO

Disease

Parkinson's disease;GAD

Disease

rate of decline in lung function in smokers;GAD

Disease

Asthma;FunDO

Disease

Multiple Myeloma;GAD

Disease

AGING;GAD

Disease

Neoplasm metastasis;FunDO

Disease

rheumatoid arthritis;GAD

Disease

Leukemia;FunDO

Disease

PHARMACOGENOMIC;GAD

Disease

Dental plaque;FunDO

Disease

Schizophrenia;FunDO

Disease

depression;GAD

Disease

METABOLIC;GAD

Disease

Tuberculosis;FunDO

Disease

Coronary Artery Disease;GAD

Disease

gastric cancer;GAD

Disease

CARDIOVASCULAR;GAD

Disease

noncardia gastric cancer;GAD

Disease

Labor, Premature;FunDO

Disease

primary open-angle glaucoma;GAD

Disease

Squamous cell cancer;FunDO

Disease

Chronic obstructive airway disease;FunDO

Disease

Alimentary system disease;FunDO

Disease

Celiac disease;FunDO

Disease

Leiomyoma;GAD

Disease

stomach cancer;GAD

Disease

Epstein-Barr virus infection;FunDO

Disease

Alzheimer's disease;GAD

Disease

Hepatitis;FunDO

Disease

Periodontitis;FunDO

Disease

Hepatitis C;FunDO

Disease

schizophrenia;GAD

Disease

Hepatitis B, Chronic;GAD

Disease

hepatocellular carcinoma;GAD

Disease

Parkinson disease;FunDO

Disease

bacterial vaginosis;GAD

Disease

decreased bone mass in patients;GAD

Disease

Cystic fibrosis;FunDO

Disease

VISION;GAD

Disease

Systemic scleroderma;FunDO

Disease

Rheumatoid arthritis;FunDO

Disease

H. pylori infection;GAD

Disease

Asthma;GAD

Disease

periodontitis;GAD

Disease

prevalent Type 2 Diabetes and related traits;GAD

Disease

Sarcoidosis;FunDO

Disease

Alzheimer's disease;FunDO

Disease

cognitive ability;GAD

Disease

Nephrosis;FunDO

Disease

Epilepsy;FunDO

Disease

Uterine Neoplasms;GAD

Disease

bone density;GAD

Disease

Multiple sclerosis;FunDO

Disease

lung cancer;GAD

Disease

CANCER;GAD

Disease

Lyme disease;FunDO

Disease

Kidney failure;FunDO

Disease

hypertension;GAD

Disease

Endometriosis;FunDO

Disease

NEUROLOGICAL;GAD

Disease

burning mouth syndrome;GAD

Disease

Gouts;FunDO

Disease

Polymyositis;FunDO

Disease

Hodgkin's disease;FunDO

Disease

RENAL;GAD

External Links

Links to Entrez Gene

3553

Links to all GeneRIF Items

3553

Links to iHOP

3553

Sequence Information

Nucleotide Sequence

>3553 : length: 810
atggcagaagtacctgagctcgccagtgaaatgatggcttattacagtggcaatgaggat
gacttgttctttgaagctgatggccctaaacagatgaagtgctccttccaggacctggac
ctctgccctctggatggcggcatccagctacgaatctccgaccaccactacagcaagggc
ttcaggcaggccgcgtcagttgttgtggccatggacaagctgaggaagatgctggttccc
tgcccacagaccttccaggagaatgacctgagcaccttctttcccttcatctttgaagaa
gaacctatcttcttcgacacatgggataacgaggcttatgtgcacgatgcacctgtacga
tcactgaactgcacgctccgggactcacagcaaaaaagcttggtgatgtctggtccatat
gaactgaaagctctccacctccagggacaggatatggagcaacaagtggtgttctccatg
tcctttgtacaaggagaagaaagtaatgacaaaatacctgtggccttgggcctcaaggaa
aagaatctgtacctgtcctgcgtgttgaaagatgataagcccactctacagctggagagt
gtagatcccaaaaattacccaaagaagaagatggaaaagcgatttgtcttcaacaagata
gaaatcaataacaagctggaatttgagtctgcccagttccccaactggtacatcagcacc
tctcaagcagaaaacatgcccgtcttcctgggagggaccaaaggcggccaggatataact
gacttcaccatgcaatttgtgtcttcctaa

Protein Sequence

>3553 : length: 269
MAEVPELASEMMAYYSGNEDDLFFEADGPKQMKCSFQDLDLCPLDGGIQLRISDHHYSKG
FRQAASVVVAMDKLRKMLVPCPQTFQENDLSTFFPFIFEEEPIFFDTWDNEAYVHDAPVR
SLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKE
KNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYIST
SQAENMPVFLGGTKGGQDITDFTMQFVSS



')