Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3486

Name

IGFBP3

Synonym

BP-53|IBP3;insulin-like growth factor binding protein 3;IGFBP3;insulin-like growth factor binding protein 3

Definition

IBP-3|IGF-binding protein 3|IGFBP-3|acid stable subunit of the 140 K IGF complex|binding protein 29|binding protein 53|growth hormone-dependent binding protein|insulin-like growth factor-binding protein 3

Position

7p13-p12

Gene Type

protein-coding

Pathways and Diseases

Pathway

p53 pathway;PANTHER;P00059

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

Diabetes pathways;Reactome;REACT:15380

Pathway

Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs);PID Reactome;500133

Pathway

Direct p53 effectors;PID Curated;200101

Pathway

p53 signaling pathway;KEGG PATHWAY;hsa04115

Disease

overall effect;GAD

Disease

Cancer;FunDO

Disease

Skin disease, Genetic;FunDO

Disease

Sickle cell disease;FunDO

Disease

Liver disease;FunDO

Disease

METABOLIC;GAD

Disease

Stroke;FunDO

Disease

Cirrhosis;FunDO

Disease

colorectal cancer;GAD

Disease

Hamman-Rich syndrome;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Gestational diabetes;FunDO

Disease

Hypothyroidism;FunDO

Disease

Growth Disorders;GAD

Disease

CANCER;GAD

Disease

Endometriosis;FunDO

Disease

Cerebral palsy;FunDO

Disease

Growth retardation;FunDO

Disease

breast cancer;GAD

Disease

Fibromyalgia;FunDO

Disease

Obesity;FunDO

Disease

insulin-like growth factor;GAD

Disease

Atherosclerosis;FunDO

Disease

Acromegaly;FunDO

Disease

Metabolic syndrome X;FunDO

External Links

Links to Entrez Gene

3486

Links to all GeneRIF Items

3486

Links to iHOP

3486

Sequence Information

Nucleotide Sequence

>3486 : length: 876
atgcagcgggcgcgacccacgctctgggccgctgcgctgactctgctggtgctgctccgc
gggccgccggtggcgcgggctggcgcgagctcggcgggcttgggtcccgtggtgcgctgc
gagccgtgcgacgcgcgtgcactggcccagtgcgcgcctccgcccgccgtgtgcgcggag
ctggtgcgcgagccgggctgcggctgctgcctgacgtgcgcactgagcgagggccagccg
tgcggcatctacaccgagcgctgtggctccggccttcgctgccagccgtcgcccgacgag
gcgcgaccgctgcaggcgctgctggacggccgcgggctctgcgtcaacgctagtgccgtc
agccgcctgcgcgcctacctgctgccagcgccgccagctccaggaaatgctagtgagtcg
gaggaagaccgcagcgccggcagtgtggagagcccgtccgtctccagcacgcaccgggtg
tctgatcccaagttccaccccctccattcaaagataatcatcatcaagaaagggcatgct
aaagacagccagcgctacaaagttgactacgagtctcagagcacagatacccagaacttc
tcctccgagtccaagcgggagacagaatatggtccctgccgtagagaaatggaagacaca
ctgaatcacctgaagttcctcaatgtgctgagtcccaggggtgtacacattcccaactgt
gacaagaagggattttataagaaaaagcagtgtcgcccttccaaaggcaggaagcggggc
ttctgctggtgtgtggataagtatgggcagcctctcccaggctacaccaccaaggggaag
gaggacgtgcactgctacagcatgcagagcaagtag

Protein Sequence

>3486 : length: 291
MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAE
LVREPGCGCCLTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAV
SRLRAYLLPAPPAPGNASESEEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHA
KDSQRYKVDYESQSTDTQNFSSESKRETEYGPCRREMEDTLNHLKFLNVLSPRGVHIPNC
DKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGKEDVHCYSMQSK



')