Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3480

Name

IGF1R

Synonym

CD221|IGFIR|IGFR|JTK13;insulin-like growth factor 1 receptor;IGF1R;insulin-like growth factor 1 receptor

Definition

IGF-I receptor|insulin-like growth factor I receptor|soluble IGF1R variant 1|soluble IGF1R variant 2

Position

15q26.3

Gene Type

protein-coding

Pathways and Diseases

Pathway

Endocytosis;KEGG PATHWAY;hsa04144

Pathway

Glioma;KEGG PATHWAY;hsa05214

Pathway

Adherens junction;KEGG PATHWAY;hsa04520

Pathway

Melanoma;KEGG PATHWAY;hsa05218

Pathway

IGF1 pathway;PID Curated;200084

Pathway

skeletal muscle hypertrophy is regulated via akt-mtor pathway;PID BioCarta;100137

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

regulation of bad phosphorylation;PID BioCarta;100233

Pathway

Plasma membrane estrogen receptor signaling;PID Curated;200029

Pathway

the igf-1 receptor and longevity;PID BioCarta;100115

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Long-term depression;KEGG PATHWAY;hsa04730

Pathway

Oocyte meiosis;KEGG PATHWAY;hsa04114

Pathway

Insulin/IGF pathway-protein kinase B signaling cascade;PANTHER;P00033

Pathway

igf-1 signaling pathway;PID BioCarta;100136

Pathway

Insulin/IGF pathway-mitogen activated protein kinase kinase/MAP kinase cascade;PANTHER;P00032

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

Stabilization and expansion of the E-cadherin adherens junction;PID Curated;200155

Pathway

multiple antiapoptotic pathways from igf-1r signaling lead to bad phosphorylation;PID BioCarta;100135

Disease

Height;NHGRI

Disease

Cancers of the lung and pleura;KEGG DISEASE

Disease

Cancers of soft tissues and bone;KEGG DISEASE

Disease

Bacteremia;GAD

Disease

Insulin-like growth factor I, resistance to;OMIM

Disease

breast cancer;GAD

Disease

Oral cancer;FunDO

Disease

Depression;FunDO

Disease

Graves' disease;FunDO

Disease

Synovial sarcoma;KEGG DISEASE;H00050

Disease

NEUROLOGICAL;GAD

Disease

INFECTION;GAD

Disease

Malignant pleural mesothelioma;KEGG DISEASE;H00015

Disease

Retinal disease;FunDO

Disease

premature pubarche;GAD

Disease

CARDIOVASCULAR;GAD

Disease

CANCER;GAD

Disease

blood pressure, arterial;GAD

Disease

Sickle cell disease;FunDO

Disease

Birth Weight;GAD

Disease

Cancer;FunDO

Disease

REPRODUCTION;GAD

Disease

Cancers;KEGG DISEASE

Disease

Osteoporosis;FunDO

Disease

Alzheimer's disease dementia;GAD

Disease

Infertility;FunDO

Disease

Septicemia;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3480

Links to all GeneRIF Items

3480

Links to iHOP

3480

Sequence Information

Nucleotide Sequence

>3480 : length: 4104
atgaagtctggctccggaggagggtccccgacctcgctgtgggggctcctgtttctctcc
gccgcgctctcgctctggccgacgagtggagaaatctgcgggccaggcatcgacatccgc
aacgactatcagcagctgaagcgcctggagaactgcacggtgatcgagggctacctccac
atcctgctcatctccaaggccgaggactaccgcagctaccgcttccccaagctcacggtc
attaccgagtacttgctgctgttccgagtggctggcctcgagagcctcggagacctcttc
cccaacctcacggtcatccgcggctggaaactcttctacaactacgccctggtcatcttc
gagatgaccaatctcaaggatattgggctttacaacctgaggaacattactcggggggcc
atcaggattgagaaaaatgctgacctctgttacctctccactgtggactggtccctgatc
ctggatgcggtgtccaataactacattgtggggaataagcccccaaaggaatgtggggac
ctgtgtccagggaccatggaggagaagccgatgtgtgagaagaccaccatcaacaatgag
tacaactaccgctgctggaccacaaaccgctgccagaaaatgtgcccaagcacgtgtggg
aagcgggcgtgcaccgagaacaatgagtgctgccaccccgagtgcctgggcagctgcagc
gcgcctgacaacgacacggcctgtgtagcttgccgccactactactatgccggtgtctgt
gtgcctgcctgcccgcccaacacctacaggtttgagggctggcgctgtgtggaccgtgac
ttctgcgccaacatcctcagcgccgagagcagcgactccgaggggtttgtgatccacgac
ggcgagtgcatgcaggagtgcccctcgggcttcatccgcaacggcagccagagcatgtac
tgcatcccttgtgaaggtccttgcccgaaggtctgtgaggaagaaaagaaaacaaagacc
attgattctgttacttctgctcagatgctccaaggatgcaccatcttcaagggcaatttg
ctcattaacatccgacgggggaataacattgcttcagagctggagaacttcatggggctc
atcgaggtggtgacgggctacgtgaagatccgccattctcatgccttggtctccttgtcc
ttcctaaaaaaccttcgcctcatcctaggagaggagcagctagaagggaattactccttc
tacgtcctcgacaaccagaacttgcagcaactgtgggactgggaccaccgcaacctgacc
atcaaagcagggaaaatgtactttgctttcaatcccaaattatgtgtttccgaaatttac
cgcatggaggaagtgacggggactaaagggcgccaaagcaaaggggacataaacaccagg
aacaacggggagagagcctcctgtgaaagtgacgtcctgcatttcacctccaccaccacg
tcgaagaatcgcatcatcataacctggcaccggtaccggccccctgactacagggatctc
atcagcttcaccgtttactacaaggaagcaccctttaagaatgtcacagagtatgatggg
caggatgcctgcggctccaacagctggaacatggtggacgtggacctcccgcccaacaag
gacgtggagcccggcatcttactacatgggctgaagccctggactcagtacgccgtttac
gtcaaggctgtgaccctcaccatggtggagaacgaccatatccgtggggccaagagtgag
atcttgtacattcgcaccaatgcttcagttccttccattcccttggacgttctttcagca
tcgaactcctcttctcagttaatcgtgaagtggaaccctccctctctgcccaacggcaac
ctgagttactacattgtgcgctggcagcggcagcctcaggacggctacctttaccggcac
aattactgctccaaagacaaaatccccatcaggaagtatgccgacggcaccatcgacatt
gaggaggtcacagagaaccccaagactgaggtgtgtggtggggagaaagggccttgctgc
gcctgccccaaaactgaagccgagaagcaggccgagaaggaggaggctgaataccgcaaa
gtctttgagaatttcctgcacaactccatcttcgtgcccagacctgaaaggaagcggaga
gatgtcatgcaagtggccaacaccaccatgtccagccgaagcaggaacaccacggccgca
gacacctacaacatcaccgacccggaagagctggagacagagtaccctttctttgagagc
agagtggataacaaggagagaactgtcatttctaaccttcggcctttcacattgtaccgc
atcgatatccacagctgcaaccacgaggctgagaagctgggctgcagcgcctccaacttc
gtctttgcaaggactatgcccgcagaaggagcagatgacattcctgggccagtgacctgg
gagccaaggcctgaaaactccatctttttaaagtggccggaacctgagaatcccaatgga
ttgattctaatgtatgaaataaaatacggatcacaagttgaggatcagcgagaatgtgtg
tccagacaggaatacaggaagtatggaggggccaagctaaaccggctaaacccggggaac
tacacagcccggattcaggccacatctctctctgggaatgggtcgtggacagatcctgtg
ttcttctatgtccaggccaaaacaggatatgaaaacttcatccatctgatcatcgctctg
cccgtcgctgtcctgttgatcgtgggagggttggtgattatgctgtacgtcttccataga
aagagaaataacagcaggctggggaatggagtgctgtatgcctctgtgaacccggagtac
ttcagcgctgctgatgtgtacgttcctgatgagtgggaggtggctcgggagaagatcacc
atgagccgggaacttgggcaggggtcgtttgggatggtctatgaaggagttgccaagggt
gtggtgaaagatgaacctgaaaccagagtggccattaaaacagtgaacgaggccgcaagc
atgcgtgagaggattgagtttctcaacgaagcttctgtgatgaaggagttcaattgtcac
catgtggtgcgattgctgggtgtggtgtcccaaggccagccaacactggtcatcatggaa
ctgatgacacggggcgatctcaaaagttatctccggtctctgaggccagaaatggagaat
aatccagtcctagcacctccaagcctgagcaagatgattcagatggccggagagattgca
gacggcatggcatacctcaacgccaataagttcgtccacagagaccttgctgcccggaat
tgcatggtagccgaagatttcacagtcaaaatcggagattttggtatgacgcgagatatc
tatgagacagactattaccggaaaggagggaaagggctgctgcccgtgcgctggatgtct
cctgagtccctcaaggatggagtcttcaccacttactcggacgtctggtccttcggggtc
gtcctctgggagatcgccacactggccgagcagccctaccagggcttgtccaacgagcaa
gtccttcgcttcgtcatggagggcggccttctggacaagccagacaactgtcctgacatg
ctgtttgaactgatgcgcatgtgctggcagtataaccccaagatgaggccttccttcctg
gagatcatcagcagcatcaaagaggagatggagcctggcttccgggaggtctccttctac
tacagcgaggagaacaagctgcccgagccggaggagctggacctggagccagagaacatg
gagagcgtccccctggacccctcggcctcctcgtcctccctgccactgcccgacagacac
tcaggacacaaggccgagaacggccccggccctggggtgctggtcctccgcgccagcttc
gacgagagacagccttacgcccacatgaacgggggccgcaagaacgagcgggccttgccg
ctgccccagtcttcgacctgctga

Protein Sequence

>3480 : length: 1367
MKSGSGGGSPTSLWGLLFLSAALSLWPTSGEICGPGIDIRNDYQQLKRLENCTVIEGYLH
ILLISKAEDYRSYRFPKLTVITEYLLLFRVAGLESLGDLFPNLTVIRGWKLFYNYALVIF
EMTNLKDIGLYNLRNITRGAIRIEKNADLCYLSTVDWSLILDAVSNNYIVGNKPPKECGD
LCPGTMEEKPMCEKTTINNEYNYRCWTTNRCQKMCPSTCGKRACTENNECCHPECLGSCS
APDNDTACVACRHYYYAGVCVPACPPNTYRFEGWRCVDRDFCANILSAESSDSEGFVIHD
GECMQECPSGFIRNGSQSMYCIPCEGPCPKVCEEEKKTKTIDSVTSAQMLQGCTIFKGNL
LINIRRGNNIASELENFMGLIEVVTGYVKIRHSHALVSLSFLKNLRLILGEEQLEGNYSF
YVLDNQNLQQLWDWDHRNLTIKAGKMYFAFNPKLCVSEIYRMEEVTGTKGRQSKGDINTR
NNGERASCESDVLHFTSTTTSKNRIIITWHRYRPPDYRDLISFTVYYKEAPFKNVTEYDG
QDACGSNSWNMVDVDLPPNKDVEPGILLHGLKPWTQYAVYVKAVTLTMVENDHIRGAKSE
ILYIRTNASVPSIPLDVLSASNSSSQLIVKWNPPSLPNGNLSYYIVRWQRQPQDGYLYRH
NYCSKDKIPIRKYADGTIDIEEVTENPKTEVCGGEKGPCCACPKTEAEKQAEKEEAEYRK
VFENFLHNSIFVPRPERKRRDVMQVANTTMSSRSRNTTAADTYNITDPEELETEYPFFES
RVDNKERTVISNLRPFTLYRIDIHSCNHEAEKLGCSASNFVFARTMPAEGADDIPGPVTW
EPRPENSIFLKWPEPENPNGLILMYEIKYGSQVEDQRECVSRQEYRKYGGAKLNRLNPGN
YTARIQATSLSGNGSWTDPVFFYVQAKTGYENFIHLIIALPVAVLLIVGGLVIMLYVFHR
KRNNSRLGNGVLYASVNPEYFSAADVYVPDEWEVAREKITMSRELGQGSFGMVYEGVAKG
VVKDEPETRVAIKTVNEAASMRERIEFLNEASVMKEFNCHHVVRLLGVVSQGQPTLVIME
LMTRGDLKSYLRSLRPEMENNPVLAPPSLSKMIQMAGEIADGMAYLNANKFVHRDLAARN
CMVAEDFTVKIGDFGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTTYSDVWSFGV
VLWEIATLAEQPYQGLSNEQVLRFVMEGGLLDKPDNCPDMLFELMRMCWQYNPKMRPSFL
EIISSIKEEMEPGFREVSFYYSEENKLPEPEELDLEPENMESVPLDPSASSSSLPLPDRH
SGHKAENGPGPGVLVLRASFDERQPYAHMNGGRKNERALPLPQSSTC



')