Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3418

Name

IDH2

Synonym

D2HGA2|ICD-M|IDH|IDHM|IDP|IDPM|mNADP-IDH;isocitrate dehydrogenase 2 (NADP+), mitochondrial;IDH2;isocitrate dehydrogenase 2 (NADP+), mitochondrial

Definition

NADP(+)-specific ICDH|isocitrate dehydrogenase [NADP], mitochondrial|oxalosuccinate decarboxylase

Position

15q26.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Pyruvate metabolism and Citric Acid (TCA) cycle;Reactome;REACT:1046

Pathway

TCA cycle;PANTHER;P00051

Pathway

Citrate cycle (TCA cycle);KEGG PATHWAY;hsa00020

Pathway

respiration (anaerobic);BioCyc;ANARESP1-PWY

Pathway

Metabolic pathways;KEGG PATHWAY;hsa01100

Pathway

Glutathione metabolism;KEGG PATHWAY;hsa00480

Pathway

Peroxisome;KEGG PATHWAY;hsa04146

Pathway

Citric acid cycle (TCA cycle);PID Reactome;500713

External Links

Links to Entrez Gene

3418

Links to all GeneRIF Items

3418

Links to iHOP

3418

Sequence Information

Nucleotide Sequence

>3418 : length: 1359
atggccggctacctgcgggtcgtgcgctcgctctgcagagcctcaggctcgcggccggcc
tgggcgccggcggccctgacagcccccacctcgcaagagcagccgcggcgccactatgcc
gacaaaaggatcaaggtggcgaagcccgtggtggagatggatggtgatgagatgacccgt
attatctggcagttcatcaaggagaagctcatcctgccccacgtggacatccagctaaag
tattttgacctcgggctcccaaaccgtgaccagactgatgaccaggtcaccattgactct
gcactggccacccagaagtacagtgtggctgtcaagtgtgccaccatcacccctgatgag
gcccgtgtggaagagttcaagctgaagaagatgtggaaaagtcccaatggaactatccgg
aacatcctgggggggactgtcttccgggagcccatcatctgcaaaaacatcccacgccta
gtccctggctggaccaagcccatcaccattggcaggcacgcccatggcgaccagtacaag
gccacagactttgtggcagaccgggccggcactttcaaaatggtcttcaccccaaaagat
ggcagtggtgtcaaggagtgggaagtgtacaacttccccgcaggcggcgtgggcatgggc
atgtacaacaccgacgagtccatctcaggttttgcgcacagctgcttccagtatgccatc
cagaagaaatggccgctgtacatgagcaccaagaacaccatactgaaagcctacgatggg
cgtttcaaggacatcttccaggagatctttgacaagcactataagaccgacttcgacaag
aataagatctggtatgagcaccggctcattgatgacatggtggctcaggtcctcaagtct
tcgggtggctttgtgtgggcctgcaagaactatgacggagatgtgcagtcagacatcctg
gcccagggctttggctcccttggcctgatgacgtccgtcctggtctgccctgatgggaag
acgattgaggctgaggccgctcatgggaccgtcacccgccactatcgggagcaccagaag
ggccggcccaccagcaccaaccccatcgccagcatctttgcctggacacgtggcctggag
caccgggggaagctggatgggaaccaagacctcatcaggtttgcccagatgctggagaag
gtgtgcgtggagacggtggagagtggagccatgaccaaggacctggcgggctgcattcac
ggcctcagcaatgtgaagctgaacgagcacttcctgaacaccacggacttcctcgacacc
atcaagagcaacctggacagagccctgggcaggcagtag

Protein Sequence

>3418 : length: 452
MAGYLRVVRSLCRASGSRPAWAPAALTAPTSQEQPRRHYADKRIKVAKPVVEMDGDEMTR
IIWQFIKEKLILPHVDIQLKYFDLGLPNRDQTDDQVTIDSALATQKYSVAVKCATITPDE
ARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLVPGWTKPITIGRHAHGDQYK
ATDFVADRAGTFKMVFTPKDGSGVKEWEVYNFPAGGVGMGMYNTDESISGFAHSCFQYAI
QKKWPLYMSTKNTILKAYDGRFKDIFQEIFDKHYKTDFDKNKIWYEHRLIDDMVAQVLKS
SGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREHQK
GRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQMLEKVCVETVESGAMTKDLAGCIH
GLSNVKLNEHFLNTTDFLDTIKSNLDRALGRQ



')