Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3398

Name

ID2

Synonym

GIG8|ID2A|ID2H|bHLHb26;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein;ID2;inhibitor of DNA binding 2, dominant negative helix-loop-helix protein

Definition

DNA-binding protein inhibitor ID-2|DNA-binding protein inhibitor ID2|cell growth-inhibiting gene 8|class B basic helix-loop-helix protein 26|helix-loop-helix protein ID2|inhibitor of differentiation 2

Position

2p25

Gene Type

protein-coding

Pathways and Diseases

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

Validated targets of C-MYC transcriptional repression;PID Curated;200171

Pathway

Regulation of Wnt-mediated beta catenin signaling and target gene transcription;PID Curated;200106

Pathway

HIF-1-alpha transcription factor network;PID Curated;200172

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Rett syndrome;FunDO

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

3398

Links to all GeneRIF Items

3398

Links to iHOP

3398

Sequence Information

Nucleotide Sequence

>3398 : length: 405
atgaaagccttcagtcccgtgaggtccgttaggaaaaacagcctgtcggaccacagcctg
ggcatctcccggagcaaaacccctgtggacgacccgatgagcctgctatacaacatgaac
gactgctactccaagctcaaggagctggtgcccagcatcccccagaacaagaaggtgagc
aagatggaaatcctgcagcacgtcatcgactacatcttggacctgcagatcgccctggac
tcgcatcccactattgtcagcctgcatcaccagagacccgggcagaaccaggcgtccagg
acgccgctgaccaccctcaacacggatatcagcatcctgtccttgcaggcttctgaattc
ccttctgagttaatgtcaaatgacagcaaagcactgtgtggctga

Protein Sequence

>3398 : length: 134
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQNQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG



')