Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3397

Name

ID1

Synonym

ID|bHLHb24;inhibitor of DNA binding 1, dominant negative helix-loop-helix protein;ID1;inhibitor of DNA binding 1, dominant negative helix-loop-helix protein

Definition

DNA-binding protein inhibitor ID-1|class B basic helix-loop-helix protein 24|dJ857M17.1.2 (inhibitor of DNA binding 1, dominant negative helix-loop-helix protein)|inhibitor of differentiation 1

Position

20q11

Gene Type

protein-coding

Pathways and Diseases

Pathway

Notch-mediated HES/HEY network;PID Curated;200196

Pathway

TGF-beta signaling pathway;KEGG PATHWAY;hsa04350

Pathway

ALK1 signaling events;PID Curated;200126

Disease

Rett syndrome;FunDO

Disease

Cancer;FunDO

External Links

Links to Entrez Gene

3397

Links to all GeneRIF Items

3397

Links to iHOP

3397

Sequence Information

Nucleotide Sequence

>3397 : length: 468
atgaaagtcgccagtggcagcaccgccaccgccgccgcgggccccagctgcgcgctgaag
gccggcaagacagcgagcggtgcgggcgaggtggtgcgctgtctgtctgagcagagcgtg
gccatctcgcgctgcgccgggggcgccggggcgcgcctgcctgccctgctggacgagcag
caggtaaacgtgctgctctacgacatgaacggctgttactcacgcctcaaggagctggtg
cccaccctgccccagaaccgcaaggtgagcaaggtggagattctccagcacgtcatcgac
tacatcagggaccttcagttggagctgaactcggaatccgaagttggaacccccgggggc
cgagggctgccggtccgggctccgctcagcaccctcaacggcgagatcagcgccctgacg
gccgaggcggcatgcgttcctgcggacgatcgcatcttgtgtcgctga

Protein Sequence

>3397 : length: 155
MKVASGSTATAAAGPSCALKAGKTASGAGEVVRCLSEQSVAISRCAGGAGARLPALLDEQ
QVNVLLYDMNGCYSRLKELVPTLPQNRKVSKVEILQHVIDYIRDLQLELNSESEVGTPGG
RGLPVRAPLSTLNGEISALTAEAACVPADDRILCR



')