Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3371

Name

TNC

Synonym

150-225|GMEM|GP|HXB|JI|TN|TN-C;tenascin C;TNC;tenascin C

Definition

GP 150-225|cytotactin|glioma-associated-extracellular matrix antigen|hexabrachion (tenascin)|myotendinous antigen|neuronectin|tenascin|tenascin-C isoform 14/AD1/16

Position

9q33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Syndecan-4-mediated signaling events;PID Curated;200115

Pathway

Integrin cell surface interactions;PID Reactome;500004

Pathway

ECM-receptor interaction;KEGG PATHWAY;hsa04512

Pathway

Integrin cell surface interactions;Reactome;REACT:13552

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Disease

Embryoma;FunDO

Disease

Tuberculosis;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Bronchopulmonary dysplasia;FunDO

Disease

Vulvar disease;FunDO

Disease

Nervous system tumor;FunDO

Disease

Lung cancer;FunDO

Disease

Respiratory failure;FunDO

Disease

Asthma;FunDO

Disease

Polyarthritis;FunDO

Disease

Oral cancer;FunDO

Disease

Sarcoidosis;FunDO

Disease

achilles tendon injuries;GAD

Disease

Endometriosis;FunDO

Disease

Colon cancer;FunDO

Disease

Breast cancer;FunDO

Disease

Hypertension, Pulmonary;FunDO

Disease

Chondrosarcoma;FunDO

External Links

Links to Entrez Gene

3371

Links to all GeneRIF Items

3371

Links to iHOP

3371

Sequence Information

Nucleotide Sequence

>3371 : length: 6606
atgggggccatgactcagctgttggcaggtgtctttcttgctttccttgccctcgctacc
gaaggtggggtcctcaagaaagtcatccggcacaagcgacagagtggggtgaacgccacc
ctgccagaagagaaccagccagtggtgtttaaccacgtttacaacatcaagctgccagtg
ggatcccagtgttcggtggatctggagtcagccagtggggagaaagacctggcaccgcct
tcagagcccagcgaaagctttcaggagcacacagtggatggggaaaaccagattgtcttc
acacatcgcatcaacatcccccgccgggcctgtggctgtgccgcagcccctgatgttaag
gagctgctgagcagactggaggagctggagaacctggtgtcttccctgagggagcaatgt
actgcaggagcaggctgctgtctccagcctgccacaggccgcttggacaccaggcccttc
tgtagcggtcggggcaacttcagcactgaaggatgtggctgtgtctgcgaacctggctgg
aaaggccccaactgctctgagcccgaatgtccaggcaactgtcaccttcgaggccggtgc
attgatgggcagtgcatctgtgacgacggcttcacgggcgaggactgcagccagctggct
tgccccagcgactgcaatgaccagggcaagtgcgtaaatggagtctgcatctgtttcgaa
ggctacgccggggctgactgcagccgtgaaatctgcccagtgccctgcagtgaggagcac
ggcacatgtgtagatggcttgtgtgtgtgccacgatggctttgcaggcgatgactgcaac
aagcctctgtgtctcaacaattgctacaaccgtggacgatgcgtggagaatgagtgcgtg
tgtgatgagggtttcacgggcgaagactgcagtgagctcatctgccccaatgactgcttc
gaccggggccgctgcatcaatggcacctgctactgcgaagaaggcttcacaggtgaagac
tgcgggaaacccacctgcccacatgcctgccacacccagggccggtgtgaggaggggcag
tgtgtatgtgatgagggctttgccggtgtggactgcagcgagaagaggtgtcctgctgac
tgtcacaatcgtggccgctgtgtagacgggcggtgtgagtgtgatgatggtttcactgga
gctgactgtggggagctcaagtgtcccaatggctgcagtggccatggccgctgtgtcaat
gggcagtgtgtgtgtgatgagggctatactggggaggactgcagccagctacggtgcccc
aatgactgtcacagtcggggccgctgtgtcgagggcaaatgtgtatgtgagcaaggcttc
aagggctatgactgcagtgacatgagctgccctaatgactgtcaccagcacggccgctgt
gtgaatggcatgtgtgtttgtgatgacggctacacaggggaagactgccgggatcgccaa
tgccccagggactgcagcaacaggggcctctgtgtggacggacagtgcgtctgtgaggac
ggcttcaccggccctgactgtgcagaactctcctgtccaaatgactgccatggccagggt
cgctgtgtgaatgggcagtgcgtgtgccatgaaggatttatgggcaaagactgcaaggag
caaagatgtcccagtgactgtcatggccagggccgctgcgtggacggccagtgcatctgc
cacgagggcttcacaggcctggactgtggccagcactcctgccccagtgactgcaacaac
ttaggacaatgcgtctcgggccgctgcatctgcaacgagggctacagcggagaagactgc
tcagaggtgtctcctcccaaagacctcgttgtgacagaagtgacggaagagacggtcaac
ctggcctgggacaatgagatgcgggtcacagagtaccttgtcgtgtacacgcccacccac
gagggtggtctggaaatgcagttccgtgtgcctggggaccagacgtccaccatcatccag
gagctggagcctggtgtggagtactttatccgtgtatttgccatcctggagaacaagaag
agcattcctgtcagcgccagggtggccacgtacttacctgcacctgaaggcctgaaattc
aagtccatcaaggagacatctgtggaagtggagtgggatcctctagacattgcttttgaa
acctgggagatcatcttccggaatatgaataaagaagatgagggagagatcaccaaaagc
ctgaggaggccagagacctcttaccggcaaactggtctagctcctgggcaagagtatgag
atatctctgcacatagtgaaaaacaatacccggggccctggcctgaagagggtgaccacc
acacgcttggatgcccccagccagatcgaggtgaaagatgtcacagacaccactgccttg
atcacctggttcaagcccctggctgagatcgatggcattgagctgacctacggcatcaaa
gacgtgccaggagaccgtaccaccatcgatctcacagaggacgagaaccagtactccatc
gggaacctgaagcctgacactgagtacgaggtgtccctcatctcccgcagaggtgacatg
tcaagcaacccagccaaagagaccttcacaacaggcctcgatgctcccaggaatcttcga
cgtgtttcccagacagataacagcatcaccctggaatggaggaatggcaaggcagctatt
gacagttacagaattaagtatgcccccatctctggaggggaccacgctgaggttgatgtt
ccaaagagccaacaagccacaaccaaaaccacactcacaggtctgaggccgggaactgaa
tatgggattggagtttctgctgtgaaggaagacaaggagagcaatccagcgaccatcaac
gcagccacagagttggacacgcccaaggaccttcaggtttctgaaactgcagagaccagc
ctgaccctgctctggaagacaccgttggccaaatttgaccgctaccgcctcaattacagt
ctccccacaggccagtgggtgggagtgcagcttccaagaaacaccacttcctatgtcctg
agaggcctggaaccaggacaggagtacaatgtcctcctgacagccgagaaaggcagacac
aagagcaagcccgcacgtgtgaaggcatccactgaacaagcccctgagctggaaaacctc
accgtgactgaggttggctgggatggcctcagactcaactggaccgcagctgaccaggcc
tatgagcactttatcattcaggtgcaggaggccaacaaggtggaggcagctcggaacctc
accgtgcctggcagccttcgggctgtggacataccgggcctcaaggctgctacgccttat
acagtctccatctatggggtgatccagggctatagaacaccagtgctctctgctgaggcc
tccacaggggaaactcccaatttgggagaggtcgtggtggccgaggtgggctgggatgcc
ctcaaactcaactggactgctccagaaggggcctatgagtactttttcattcaggtgcag
gaggctgacacagtagaggcagcccagaacctcaccgtcccaggaggactgaggtccaca
gacctgcctgggctcaaagcagccactcattataccatcaccatccgcggggtcactcag
gacttcagcacaacccctctctctgttgaagtcttgacagaggaggttccagatatggga
aacctcacagtgaccgaggttagctgggatgctctcagactgaactggaccacgccagat
ggaacctatgaccagtttactattcaggtccaggaggctgaccaggtggaagaggctcac
aatctcacggttcctggcagcctgcgttccatggaaatcccaggcctcagggctggcact
ccttacacagtcaccctgcacggcgaggtcaggggccacagcactcgaccccttgctgta
gaggtcgtcacagaggatctcccacagctgggagatttagccgtgtctgaggttggctgg
gatggcctcagactcaactggaccgcagctgacaatgcctatgagcactttgtcattcag
gtgcaggaggtcaacaaagtggaggcagcccagaacctcacgttgcctggcagcctcagg
gctgtggacatcccgggcctcgaggctgccacgccttatagagtctccatctatggggtg
atccggggctatagaacaccagtactctctgctgaggcctccacagccaaagaacctgaa
attggaaacttaaatgtttctgacataactcccgagagcttcaatctctcctggatggct
accgatgggatcttcgagacctttaccattgaaattattgattccaataggttgctggag
actgtggaatataatatctctggtgctgaacgaactgcccatatctcagggctaccccct
agtactgattttattgtctacctctctggacttgctcccagcatccggaccaaaaccatc
agtgccacagccacgacagaggccctgccccttctggaaaacctaaccatttccgacatt
aatccctacgggttcacagtttcctggatggcatcggagaatgcctttgacagctttcta
gtaacggtggtggattctgggaagctgctggacccccaggaattcacactttcaggaacc
cagaggaagctggagcttagaggcctcataactggcattggctatgaggttatggtctct
ggcttcacccaagggcatcaaaccaagcccttgagggctgagattgttacagaagccgaa
ccggaagttgacaaccttctggtttcagatgccaccccagacggtttccgtctgtcctgg
acagctgatgaaggggtcttcgacaattttgttctcaaaatcagagataccaaaaagcag
tctgagccactggaaataaccctacttgcccccgaacgtaccagggacataacaggtctc
agagaggctactgaatacgaaattgaactctatggaataagcaaaggaaggcgatcccag
acagtcagtgctatagcaacaacagccatgggctccccaaaggaagtcattttctcagac
atcactgaaaattcggctactgtcagctggagggcacccacagcccaagtggagagcttc
cggattacctatgtgcccattacaggaggtacaccctccatggtaactgtggacggaacc
aagactcagaccaggctggtgaaactcatacctggcgtggagtaccttgtcagcatcatc
gccatgaagggctttgaggaaagtgaacctgtctcagggtcattcaccacagctctggat
ggcccatctggcctggtgacagccaacatcactgactcagaagccttggccaggtggcag
ccagccattgccactgtggacagttatgtcatctcctacacaggcgagaaagtgccagaa
attacacgcacggtgtccgggaacacagtggagtatgctctgaccgacctcgagcctgcc
acggaatacacactgagaatctttgcagagaaagggccccagaagagctcaaccatcact
gccaagttcacaacagacctcgattctccaagagacttgactgctactgaggttcagtcg
gaaactgccctccttacctggcgacccccccgggcatcagtcaccggttacctgctggtc
tatgaatcagtggatggcacagtcaaggaagtcattgtgggtccagataccacctcctac
agcctggcagacctgagcccatccacccactacacagccaagatccaggcactcaatggg
cccctgaggagcaatatgatccagaccatcttcaccacaattggactcctgtaccccttc
cccaaggactgctcccaagcaatgctgaatggagacacgacctctggcctctacaccatt
tatctgaatggtgataaggctgaggcgctggaagtcttctgtgacatgacctctgatggg
ggtggatggattgtgttcctgagacgcaaaaacggacgcgagaacttctaccaaaactgg
aaggcatatgctgctggatttggggaccgcagagaagaattctggcttgggctggacaac
ctgaacaaaatcacagcccaggggcagtacgagctccgggtggacctgcgggaccatggg
gagacagcctttgctgtctatgacaagttcagcgtgggagatgccaagactcgctacaag
ctgaaggtggaggggtacagtgggacagcaggtgactccatggcctaccacaatggcaga
tccttctccacctttgacaaggacacagattcagccatcaccaactgtgctctgtcctac
aaaggggctttctggtacaggaactgtcaccgtgtcaacctgatggggagatatggggac
aataaccacagtcagggcgttaactggttccactggaagggccacgaacactcaatccag
tttgctgagatgaagctgagaccaagcaacttcagaaatcttgaaggcaggcgcaaacgg
gcataa

Protein Sequence

>3371 : length: 2201
MGAMTQLLAGVFLAFLALATEGGVLKKVIRHKRQSGVNATLPEENQPVVFNHVYNIKLPV
GSQCSVDLESASGEKDLAPPSEPSESFQEHTVDGENQIVFTHRINIPRRACGCAAAPDVK
ELLSRLEELENLVSSLREQCTAGAGCCLQPATGRLDTRPFCSGRGNFSTEGCGCVCEPGW
KGPNCSEPECPGNCHLRGRCIDGQCICDDGFTGEDCSQLACPSDCNDQGKCVNGVCICFE
GYAGADCSREICPVPCSEEHGTCVDGLCVCHDGFAGDDCNKPLCLNNCYNRGRCVENECV
CDEGFTGEDCSELICPNDCFDRGRCINGTCYCEEGFTGEDCGKPTCPHACHTQGRCEEGQ
CVCDEGFAGVDCSEKRCPADCHNRGRCVDGRCECDDGFTGADCGELKCPNGCSGHGRCVN
GQCVCDEGYTGEDCSQLRCPNDCHSRGRCVEGKCVCEQGFKGYDCSDMSCPNDCHQHGRC
VNGMCVCDDGYTGEDCRDRQCPRDCSNRGLCVDGQCVCEDGFTGPDCAELSCPNDCHGQG
RCVNGQCVCHEGFMGKDCKEQRCPSDCHGQGRCVDGQCICHEGFTGLDCGQHSCPSDCNN
LGQCVSGRCICNEGYSGEDCSEVSPPKDLVVTEVTEETVNLAWDNEMRVTEYLVVYTPTH
EGGLEMQFRVPGDQTSTIIQELEPGVEYFIRVFAILENKKSIPVSARVATYLPAPEGLKF
KSIKETSVEVEWDPLDIAFETWEIIFRNMNKEDEGEITKSLRRPETSYRQTGLAPGQEYE
ISLHIVKNNTRGPGLKRVTTTRLDAPSQIEVKDVTDTTALITWFKPLAEIDGIELTYGIK
DVPGDRTTIDLTEDENQYSIGNLKPDTEYEVSLISRRGDMSSNPAKETFTTGLDAPRNLR
RVSQTDNSITLEWRNGKAAIDSYRIKYAPISGGDHAEVDVPKSQQATTKTTLTGLRPGTE
YGIGVSAVKEDKESNPATINAATELDTPKDLQVSETAETSLTLLWKTPLAKFDRYRLNYS
LPTGQWVGVQLPRNTTSYVLRGLEPGQEYNVLLTAEKGRHKSKPARVKASTEQAPELENL
TVTEVGWDGLRLNWTAADQAYEHFIIQVQEANKVEAARNLTVPGSLRAVDIPGLKAATPY
TVSIYGVIQGYRTPVLSAEASTGETPNLGEVVVAEVGWDALKLNWTAPEGAYEYFFIQVQ
EADTVEAAQNLTVPGGLRSTDLPGLKAATHYTITIRGVTQDFSTTPLSVEVLTEEVPDMG
NLTVTEVSWDALRLNWTTPDGTYDQFTIQVQEADQVEEAHNLTVPGSLRSMEIPGLRAGT
PYTVTLHGEVRGHSTRPLAVEVVTEDLPQLGDLAVSEVGWDGLRLNWTAADNAYEHFVIQ
VQEVNKVEAAQNLTLPGSLRAVDIPGLEAATPYRVSIYGVIRGYRTPVLSAEASTAKEPE
IGNLNVSDITPESFNLSWMATDGIFETFTIEIIDSNRLLETVEYNISGAERTAHISGLPP
STDFIVYLSGLAPSIRTKTISATATTEALPLLENLTISDINPYGFTVSWMASENAFDSFL
VTVVDSGKLLDPQEFTLSGTQRKLELRGLITGIGYEVMVSGFTQGHQTKPLRAEIVTEAE
PEVDNLLVSDATPDGFRLSWTADEGVFDNFVLKIRDTKKQSEPLEITLLAPERTRDITGL
REATEYEIELYGISKGRRSQTVSAIATTAMGSPKEVIFSDITENSATVSWRAPTAQVESF
RITYVPITGGTPSMVTVDGTKTQTRLVKLIPGVEYLVSIIAMKGFEESEPVSGSFTTALD
GPSGLVTANITDSEALARWQPAIATVDSYVISYTGEKVPEITRTVSGNTVEYALTDLEPA
TEYTLRIFAEKGPQKSSTITAKFTTDLDSPRDLTATEVQSETALLTWRPPRASVTGYLLV
YESVDGTVKEVIVGPDTTSYSLADLSPSTHYTAKIQALNGPLRSNMIQTIFTTIGLLYPF
PKDCSQAMLNGDTTSGLYTIYLNGDKAEALEVFCDMTSDGGGWIVFLRRKNGRENFYQNW
KAYAAGFGDRREEFWLGLDNLNKITAQGQYELRVDLRDHGETAFAVYDKFSVGDAKTRYK
LKVEGYSGTAGDSMAYHNGRSFSTFDKDTDSAITNCALSYKGAFWYRNCHRVNLMGRYGD
NNHSQGVNWFHWKGHEHSIQFAEMKLRPSNFRNLEGRRKRA



')