Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3320

Name

HSP90AA1

Synonym

HSP86|HSP89A|HSP90A|HSP90N|HSPC1|HSPCA|HSPCAL1|HSPCAL4|HSPN|Hsp89|Hsp90|LAP2;heat shock protein 90kDa alpha (cytosolic), class A member 1;HSP90AA1;heat shock protein 90kDa alpha (cytosolic), class A member 1

Definition

HSP 86|heat shock 86 kDa|heat shock 90kD protein 1, alpha|heat shock 90kD protein 1, alpha-like 4|heat shock 90kD protein, alpha-like 4|heat shock 90kDa protein 1, alpha|heat shock protein HSP 90-alpha|renal carcinoma antigen NY-REN-38

Position

14q32.33

Gene Type

protein-coding

Pathways and Diseases

Pathway

Class I PI3K signaling events mediated by Akt;PID Curated;200169

Pathway

Glucocorticoid receptor regulatory network;PID Curated;200077

Pathway

Axon guidance;Reactome;REACT:18266

Pathway

mechanism of gene regulation by peroxisome proliferators via ppara;PID BioCarta;100066

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

ahr signal transduction pathway;PID BioCarta;100251

Pathway

Hypoxic and oxygen homeostasis regulation of HIF-1-alpha;PID Curated;200122

Pathway

VEGFR1 specific signals;PID Curated;200151

Pathway

ion channels and their functional role in vascular endothelium;PID BioCarta;100055

Pathway

Loss of Nlp from mitotic centrosomes;PID Reactome;500384

Pathway

akt signaling pathway;PID BioCarta;100245

Pathway

Class I PI3K signaling events;PID Curated;200098

Pathway

Regulation of Telomerase;PID Curated;200072

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

corticosteroids and cardioprotection;PID BioCarta;100156

Pathway

tumor suppressor arf inhibits ribosomal biogenesis;PID BioCarta;100237

Pathway

eNOS activation;PID Reactome;500849

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Pathway

Metabolism of nitric oxide;Reactome;REACT:12508

Pathway

LKB1 signaling events;PID Curated;200061

Pathway

Signaling events mediated by HDAC Class II;PID Curated;200019

Pathway

hypoxia and p53 in the cardiovascular system;PID BioCarta;100084

Pathway

Regulation of Androgen receptor activity;PID Curated;200102

Pathway

Progesterone-mediated oocyte maturation;KEGG PATHWAY;hsa04914

Pathway

hypoxia-inducible factor in the cardivascular system;PID BioCarta;100145

Pathway

Prostate cancer;KEGG PATHWAY;hsa05215

Pathway

Cell Cycle, Mitotic;Reactome;REACT:152

Pathway

ErbB receptor signaling network;PID Curated;200136

Pathway

Protein processing in endoplasmic reticulum;KEGG PATHWAY;hsa04141

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

actions of nitric oxide in the heart;PID BioCarta;100094

Pathway

vRNP Assembly;PID Reactome;500689

Pathway

Integrins in angiogenesis;PID Curated;200109

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

vegf hypoxia and angiogenesis;PID BioCarta;100006

Pathway

IL2 signaling events mediated by PI3K;PID Curated;200099

Pathway

Loss of proteins required for interphase microtubule organization from the centrosome;PID Reactome;500383

Disease

Herpes;FunDO

Disease

Alzheimer's disease;FunDO

Disease

Fanconi's anemia;FunDO

Disease

Cancer;FunDO

Disease

Eating disorder;FunDO

External Links

Links to Entrez Gene

3320

Links to all GeneRIF Items

3320

Links to iHOP

3320

Sequence Information

Nucleotide Sequence

>3320 : length: 2565
atgcccccgtgttcgggcggggacggctccacccctcctgggccctcccttcgggacagg
gactgtcccgcccagagtgctgaatacccgcgcgaccgtctggatccccgcccaggaagc
ccctctgaagcctcctcgccgccgtttctgagaagcagggcacctgttaactggtaccaa
gaaaaggcccaagtgtttctctggcatctgatggtgtctggatccaccactctactctgt
ctctggaaacagcccttccacgtctctgcattccctgtcaccgcgtcactggccttcaga
cagagccaaggtgcagggcaacacctctacaaggatctgcagccatttatattgcttagg
ctactgatgcctgaggaaacccagacccaagaccaaccgatggaggaggaggaggttgag
acgttcgcctttcaggcagaaattgcccagttgatgtcattgatcatcaatactttctac
tcgaacaaagagatctttctgagagagctcatttcaaattcatcagatgcattggacaaa
atccggtatgaaagcttgacagatcccagtaaattagactctgggaaagagctgcatatt
aaccttataccgaacaaacaagatcgaactctcactattgtggatactggaattggaatg
accaaggctgacttgatcaataaccttggtactatcgccaagtctgggaccaaagcgttc
atggaagctttgcaggctggtgcagatatctctatgattggccagttcggtgttggtttt
tattctgcttatttggttgctgagaaagtaactgtgatcaccaaacataacgatgatgag
cagtacgcttgggagtcctcagcagggggatcattcacagtgaggacagacacaggtgaa
cctatgggtcgtggaacaaaagttatcctacacctgaaagaagaccaaactgagtacttg
gaggaacgaagaataaaggagattgtgaagaaacattctcagtttattggatatcccatt
actctttttgtggagaaggaacgtgataaagaagtaagcgatgatgaggctgaagaaaag
gaagacaaagaagaagaaaaagaaaaagaagagaaagagtcggaagacaaacctgaaatt
gaagatgttggttctgatgaggaagaagaaaagaaggatggtgacaagaagaagaagaag
aagattaaggaaaagtacatcgatcaagaagagctcaacaaaacaaagcccatctggacc
agaaatcccgacgatattactaatgaggagtacggagaattctataagagcttgaccaat
gactgggaagatcacttggcagtgaagcatttttcagttgaaggacagttggaattcaga
gcccttctatttgtcccacgacgtgctccttttgatctgtttgaaaacagaaagaaaaag
aacaacatcaaattgtatgtacgcagagttttcatcatggataactgtgaggagctaatc
cctgaatatctgaacttcattagaggggtggtagactcggaggatctccctctaaacata
tcccgtgagatgttgcaacaaagcaaaattttgaaagttatcaggaagaatttggtcaaa
aaatgcttagaactctttactgaactggcggaagataaagagaactacaagaaattctat
gagcagttctctaaaaacataaagcttggaatacacgaagactctcaaaatcggaagaag
ctttcagagctgttaaggtactacacatctgcctctggtgatgagatggtttctctcaag
gactactgcaccagaatgaaggagaaccagaaacatatctattatatcacaggtgagacc
aaggaccaggtagctaactcagcctttgtggaacgtcttcggaaacatggcttagaagtg
atctatatgattgagcccattgatgagtactgtgtccaacagctgaaggaatttgagggg
aagactttagtgtcagtcaccaaagaaggcctggaacttccagaggatgaagaagagaaa
aagaagcaggaagagaaaaaaacaaagtttgagaacctctgcaaaatcatgaaagacata
ttggagaaaaaagttgaaaaggtggttgtgtcaaaccgattggtgacatctccatgctgt
attgtcacaagcacatatggctggacagcaaacatggagagaatcatgaaagctcaagcc
ctaagagacaactcaacaatgggttacatggcagcaaagaaacacctggagataaaccct
gaccattccattattgagaccttaaggcaaaaggcagaggctgataagaacgacaagtct
gtgaaggatctggtcatcttgctttatgaaactgcgctcctgtcttctggcttcagtctg
gaagatccccagacacatgctaacaggatctacaggatgatcaaacttggtctgggtatt
gatgaagatgaccctactgctgatgataccagtgctgctgtaactgaagaaatgccaccc
cttgaaggagatgacgacacatcacgcatggaagaagtagactaa

Protein Sequence

>3320 : length: 854
MPPCSGGDGSTPPGPSLRDRDCPAQSAEYPRDRLDPRPGSPSEASSPPFLRSRAPVNWYQ
EKAQVFLWHLMVSGSTTLLCLWKQPFHVSAFPVTASLAFRQSQGAGQHLYKDLQPFILLR
LLMPEETQTQDQPMEEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNSSDALDK
IRYESLTDPSKLDSGKELHINLIPNKQDRTLTIVDTGIGMTKADLINNLGTIAKSGTKAF
MEALQAGADISMIGQFGVGFYSAYLVAEKVTVITKHNDDEQYAWESSAGGSFTVRTDTGE
PMGRGTKVILHLKEDQTEYLEERRIKEIVKKHSQFIGYPITLFVEKERDKEVSDDEAEEK
EDKEEEKEKEEKESEDKPEIEDVGSDEEEEKKDGDKKKKKKIKEKYIDQEELNKTKPIWT
RNPDDITNEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFVPRRAPFDLFENRKKK
NNIKLYVRRVFIMDNCEELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNLVK
KCLELFTELAEDKENYKKFYEQFSKNIKLGIHEDSQNRKKLSELLRYYTSASGDEMVSLK
DYCTRMKENQKHIYYITGETKDQVANSAFVERLRKHGLEVIYMIEPIDEYCVQQLKEFEG
KTLVSVTKEGLELPEDEEEKKKQEEKKTKFENLCKIMKDILEKKVEKVVVSNRLVTSPCC
IVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEADKNDKS
VKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGIDEDDPTADDTSAAVTEEMPP
LEGDDDTSRMEEVD



')