Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3316

Name

HSPB2

Synonym

HSP27|Hs.78846|LOH11CR1K|MKBP;heat shock 27kDa protein 2;HSPB2;heat shock 27kDa protein 2

Definition

DMPK-binding protein|heat shock 27kD protein 2|heat shock protein beta-2|heat-shock protein beta-2

Position

11q22-q23

Gene Type

protein-coding

Pathways and Diseases

Pathway

VEGF signaling pathway;PANTHER;P00056

Pathway

Angiogenesis;PANTHER;P00005

Disease

Alzheimer's disease;FunDO

Disease

Diabetes mellitus;FunDO

External Links

Links to Entrez Gene

3316

Links to all GeneRIF Items

3316

Links to iHOP

3316

Sequence Information

Nucleotide Sequence

>3316 : length: 549
atgtcgggccgctcagtgccacatgcccacccggccaccgccgagtacgaatttgccaac
ccgagccgcctgggtgagcagcgcttcggagaaggcctcctgccagaagagatcctgacc
cccacactctaccatggctactatgtccggcctcgggccgccccagctggggagggcagc
agggcaggggcctccgagcttaggctcagtgagggcaagttccaggcatttctggatgtg
agccactttaccccagacgaggtgactgtgaggactgtggataacctgctggaggtgtct
gcccggcacccccagcgcctggaccgccacggcttcgtgtcccgagagttctgccgcacc
tatgtcctgcctgctgatgtcgacccctggcgagtccgagctgctctctcccatgatggc
atcttaaacctggaagcacctcggggtggccgacatttggacacagaggtcaatgaggtc
tacatctccctgctccctgcgcctcctgatccagaggaagaggaggaggcagccatagtt
gagccctga

Protein Sequence

>3316 : length: 182
MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGS
RAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRT
YVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIV
EP



')