Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3315

Name

HSPB1

Synonym

CMT2F|HMN2B|HS.76067|HSP27|HSP28|Hsp25|SRP27;heat shock 27kDa protein 1;HSPB1;heat shock 27kDa protein 1

Definition

28 kDa heat shock protein|HSP 27|estrogen-regulated 24 kDa protein|heat shock 27 kDa protein|heat shock 27kD protein 1|heat shock protein beta-1|stress-responsive protein 27

Position

7q11.23

Gene Type

protein-coding

Pathways and Diseases

Pathway

Signaling events mediated by VEGFR1 and VEGFR2;PID Curated;200161

Pathway

downregulated of mta-3 in er-negative breast tumors;PID BioCarta;100102

Pathway

Amoebiasis;KEGG PATHWAY;hsa05146

Pathway

p38 signaling mediated by MAPKAP kinases;PID Curated;200135

Pathway

VEGF signaling pathway;KEGG PATHWAY;hsa04370

Pathway

MAPK signaling pathway;KEGG PATHWAY;hsa04010

Pathway

stress induction of hsp regulation;PID BioCarta;100142

Pathway

p38 mapk signaling pathway;PID BioCarta;100085

Pathway

Signaling mediated by p38-alpha and p38-beta;PID Curated;200154

Disease

Renal Cell cancer;FunDO

Disease

Charcot-Marie-Tooth disease;FunDO

Disease

Squamous cell cancer;FunDO

Disease

Diabetes mellitus;FunDO

Disease

Dermatitis;FunDO

Disease

Prostate cancer;FunDO

Disease

Neuropathy, distal hereditary motor, type IIB;OMIM

Disease

Liver tumor;FunDO

Disease

Multiple myeloma;FunDO

Disease

Liver disease;FunDO

Disease

Barrett's esophagus;FunDO

Disease

Aortic aneurysm;FunDO

Disease

Spinal cord disease;FunDO

Disease

Ewings sarcoma;FunDO

Disease

Dental plaque;FunDO

Disease

Charcot-Marie-Tooth disease, axonal, type 2F;OMIM

Disease

Asthma;FunDO

Disease

Liver cancer;FunDO

Disease

HIV infection;FunDO

Disease

Aortic valve disease;FunDO

Disease

Atherosclerosis;FunDO

External Links

Links to Entrez Gene

3315

Links to all GeneRIF Items

3315

Links to iHOP

3315

Sequence Information

Nucleotide Sequence

>3315 : length: 618
atgaccgagcgccgcgtccccttctcgctcctgcggggccccagctgggaccccttccgc
gactggtacccgcatagccgcctcttcgaccaggccttcgggctgccccggctgccggag
gagtggtcgcagtggttaggcggcagcagctggccaggctacgtgcgccccctgcccccc
gccgccatcgagagccccgcagtggccgcgcccgcctacagccgcgcgctcagccggcaa
ctcagcagcggggtctcggagatccggcacactgcggaccgctggcgcgtgtccctggat
gtcaaccacttcgccccggacgagctgacggtcaagaccaaggatggcgtggtggagatc
accggcaagcacgaggagcggcaggacgagcatggctacatctcccggtgcttcacgcgg
aaatacacgctgccccccggtgtggaccccacccaagtttcctcctccctgtcccctgag
ggcacactgaccgtggaggcccccatgcccaagctagccacgcagtccaacgagatcacc
atcccagtcaccttcgagtcgcgggcccagcttgggggcccagaagctgcaaaatccgat
gagactgccgccaagtaa

Protein Sequence

>3315 : length: 205
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPP
AAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEI
TGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEIT
IPVTFESRAQLGGPEAAKSDETAAK



')