Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3308

Name

HSPA4

Synonym

APG-2|HS24/P52|HSPH2|RY|hsp70|hsp70RY;heat shock 70kDa protein 4;HSPA4;heat shock 70kDa protein 4

Definition

heat shock 70 kDa protein 4|heat shock 70-related protein APG-2|heat shock 70kD protein 4|heat shock protein, 110 kDa|hsp70 RY

Position

5q31.1

Gene Type

protein-coding

Pathways and Diseases

Pathway

Antigen processing and presentation;KEGG PATHWAY;hsa04612

Pathway

Validated targets of C-MYC transcriptional activation;PID Curated;200045

Disease

Drug abuse;FunDO

Disease

Renal Cell cancer;FunDO

Disease

REPRODUCTION;GAD

Disease

Ischemia;FunDO

Disease

preterm delivery;GAD

Disease

Leukemia;FunDO

Disease

Liver cancer;FunDO

Disease

Neoplasm metastasis;FunDO

External Links

Links to Entrez Gene

3308

Links to all GeneRIF Items

3308

Links to iHOP

3308

Sequence Information

Nucleotide Sequence

>3308 : length: 2523
atgtcggtggtgggcatagacctgggcttccagagctgctacgtcgctgtggcccgcgcc
ggcggcatcgagactatcgctaatgagtatagcgaccgctgcacgccggcttgcatttct
tttggtcctaagaatcgttcaattggagcagcagctaaaagccaggtaatttctaatgca
aagaacacagtccaaggatttaaaagattccatggccgagcattctctgatccatttgtg
gaggcagaaaaatctaaccttgcatatgatattgtgcagttgcctacaggattaacaggt
ataaaggtgacatatatggaggaagagcgaaattttaccactgagcaagtgactgccatg
cttttgtccaaactgaaggagacagccgaaagtgttcttaagaagcctgtagttgactgt
gttgtttcggttccttgtttctatactgatgcagaaagacgatcagtgatggatgcaaca
cagattgctggtcttaattgcttgcgattaatgaatgaaaccactgcagttgctcttgca
tatggaatctataagcaggatcttcctgccttagaagagaaaccaagaaatgtagttttt
gtagacatgggccactctgcttatcaagtttctgtatgtgcatttaatagaggaaaactg
aaagttctggccactgcatttgacacgacattgggaggtagaaaatttgatgaagtgtta
gtaaatcacttctgtgaagaatttgggaagaaatacaagctagacattaagtccaaaatc
cgtgcattattacgactctctcaggagtgtgagaaactcaagaaattgatgagtgcaaat
gcttcagatctccctttgagcattgaatgttttatgaatgatgttgatgtatctggaact
atgaatagaggcaaatttctggagatgtgcaatgatctcttagctagagtggagccacca
cttcgtagtgttttggaacaaaccaagttaaagaaagaagatatttatgcagtggagata
gttggtggtgctacacgaatccctgcggtaaaagagaagatcagcaaatttttcggtaaa
gaacttagtacaacattaaatgctgatgaagctgtcactcgaggctgtgcattgcagtgt
gccatcttatcgcctgctttcaaagtcagagaattttctatcactgatgtagtaccatat
ccaatatctctgagatggaattctccagctgaagaagggtcaagtgactgtgaagtcttt
tccaaaaatcatgctgctcctttctctaaagttcttacattttatagaaaggaacctttc
actcttgaggcctactacagctctcctcaggatttgccctatccagatcctgctatagct
cagttttcagttcagaaagtcactcctcagtctgatggctccagttcaaaagtgaaagtc
aaagttcgagtaaatgtccatggcattttcagtgtgtccagtgcatctttagtggaggtt
cacaagtctgaggaaaatgaggagccaatggaaacagatcagaatgcaaaggaggaagag
aagatgcaagtggaccaggaggaaccacatgttgaagagcaacagcagcagacaccagca
gaaaataaggcagagtctgaagaaatggagacctctcaagctggatccaaggataaaaag
atggaccaaccaccccaagccaagaaggcaaaagtgaagaccagtactgtggacctgcca
atcgagaatcagctattatggcagatagacagagagatgctcaacttgtacattgaaaat
gagggtaagatgatcatgcaggataaactggagaaggagcggaatgatgctaagaacgca
gtggaggaatatgtgtatgaaatgagagacaagcttagtggtgaatatgagaagtttgtg
agtgaagatgatcgtaacagttttactttgaaactggaagatactgaaaattggttgtat
gaggatggagaagaccagccaaagcaagtttatgttgataagttggctgaattaaaaaat
ctaggtcaacctattaagatacgtttccaggaatctgaagaacgaccaaaattatttgaa
gaactagggaaacagatccaacagtatatgaaaataatcagctctttcaaaaacaaggag
gaccagtatgatcatttggatgctgctgacatgacaaaggtagaaaaaagcacaaatgaa
gcaatggagtggatgaataacaagctaaatctgcagaacaagcagagtttgaccatggat
ccagttgtcaagtcaaaagagattgaagctaaaattaaggagctgacaagtacttgtagc
cctataatttcaaagcccaaacccaaagtggaacctccaaaagaggaacaaaaaaatgca
gagcagaatggaccagtggatggacaaggagacaacccaggcccccaggctgctgagcag
ggtacagacacagctgtgccttcggattcagacaagaagcttcctgaaatggacattgat
tga

Protein Sequence

>3308 : length: 840
MSVVGIDLGFQSCYVAVARAGGIETIANEYSDRCTPACISFGPKNRSIGAAAKSQVISNA
KNTVQGFKRFHGRAFSDPFVEAEKSNLAYDIVQLPTGLTGIKVTYMEEERNFTTEQVTAM
LLSKLKETAESVLKKPVVDCVVSVPCFYTDAERRSVMDATQIAGLNCLRLMNETTAVALA
YGIYKQDLPALEEKPRNVVFVDMGHSAYQVSVCAFNRGKLKVLATAFDTTLGGRKFDEVL
VNHFCEEFGKKYKLDIKSKIRALLRLSQECEKLKKLMSANASDLPLSIECFMNDVDVSGT
MNRGKFLEMCNDLLARVEPPLRSVLEQTKLKKEDIYAVEIVGGATRIPAVKEKISKFFGK
ELSTTLNADEAVTRGCALQCAILSPAFKVREFSITDVVPYPISLRWNSPAEEGSSDCEVF
SKNHAAPFSKVLTFYRKEPFTLEAYYSSPQDLPYPDPAIAQFSVQKVTPQSDGSSSKVKV
KVRVNVHGIFSVSSASLVEVHKSEENEEPMETDQNAKEEEKMQVDQEEPHVEEQQQQTPA
ENKAESEEMETSQAGSKDKKMDQPPQAKKAKVKTSTVDLPIENQLLWQIDREMLNLYIEN
EGKMIMQDKLEKERNDAKNAVEEYVYEMRDKLSGEYEKFVSEDDRNSFTLKLEDTENWLY
EDGEDQPKQVYVDKLAELKNLGQPIKIRFQESEERPKLFEELGKQIQQYMKIISSFKNKE
DQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCS
PIISKPKPKVEPPKEEQKNAEQNGPVDGQGDNPGPQAAEQGTDTAVPSDSDKKLPEMDID



')