Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

329

Name

BIRC2

Synonym

API1|HIAP2|Hiap-2|MIHB|RNF48|c-IAP1|cIAP1;baculoviral IAP repeat containing 2;BIRC2;baculoviral IAP repeat containing 2

Definition

IAP homolog B|IAP-2|NFR2-TRAF signalling complex protein|RING finger protein 48|TNFR2-TRAF-signaling complex protein 2|apoptosis inhibitor 1|baculoviral IAP repeat-containing 2|baculoviral IAP repeat-containing protein 2|inhibitor of apoptosis protein 2

Position

11q22

Gene Type

protein-coding

Pathways and Diseases

Pathway

Apoptosis;Reactome;REACT:578

Pathway

TNF receptor signaling pathway;PID Curated;200086

Pathway

Focal adhesion;KEGG PATHWAY;hsa04510

Pathway

Pathways in cancer;KEGG PATHWAY;hsa05200

Pathway

NOD-like receptor signaling pathway;KEGG PATHWAY;hsa04621

Pathway

Apoptosis;KEGG PATHWAY;hsa04210

Pathway

Ubiquitin mediated proteolysis;KEGG PATHWAY;hsa04120

Pathway

hiv-1 nef: negative effector of fas and tnf;PID BioCarta;100144

Pathway

keratinocyte differentiation;PID BioCarta;100119

Pathway

role of mitochondria in apoptotic signaling;PID BioCarta;100106

Pathway

Apoptosis signaling pathway;PANTHER;P00006

Pathway

Small cell lung cancer;KEGG PATHWAY;hsa05222

Pathway

Caspase cascade in apoptosis;PID Curated;200148

Pathway

CD40/CD40L signaling;PID Curated;200031

Pathway

Canonical NF-kappaB pathway;PID Curated;200026

Pathway

Toxoplasmosis;KEGG PATHWAY;hsa05145

Pathway

Apoptotic cleavage of cellular proteins;PID Reactome;500270

Disease

Schizophrenia;FunDO

Disease

Cancer;FunDO

Disease

Multiple sclerosis;FunDO

External Links

Links to Entrez Gene

329

Links to all GeneRIF Items

329

Links to iHOP

329

Sequence Information

Nucleotide Sequence

>329 : length: 1857
atgcacaaaactgcctcccaaagacttttcccaggtccctcgtatcaaaacattaagagt
ataatggaagatagcacgatcttgtcagattggacaaacagcaacaaacaaaaaatgaag
tatgacttttcctgtgaactctacagaatgtctacatattcaactttccccgccggggtg
cctgtctcagaaaggagtcttgctcgtgctggtttttattatactggtgtgaatgacaag
gtcaaatgcttctgttgtggcctgatgctggataactggaaactaggagacagtcctatt
caaaagcataaacagctatatcctagctgtagctttattcagaatctggtttcagctagt
ctgggatccacctctaagaatacgtctccaatgagaaacagttttgcacattcattatct
cccaccttggaacatagtagcttgttcagtggttcttactccagcctttctccaaaccct
cttaattctagagcagttgaagacatctcttcatcgaggactaacccctacagttatgca
atgagtactgaagaagccagatttcttacctaccatatgtggccattaacttttttgtca
ccatcagaattggcaagagctggtttttattatataggacctggagatagggtagcctgc
tttgcctgtggtgggaagctcagtaactgggaaccaaaggatgatgctatgtcagaacac
cggaggcattttcccaactgtccatttttggaaaattctctagaaactctgaggtttagc
atttcaaatctgagcatgcagacacatgcagctcgaatgagaacatttatgtactggcca
tctagtgttccagttcagcctgagcagcttgcaagtgctggtttttattatgtgggtcgc
aatgatgatgtcaaatgcttttgttgtgatggtggcttgaggtgttgggaatctggagat
gatccatgggtagaacatgccaagtggtttccaaggtgtgagttcttgatacgaatgaaa
ggccaagagtttgttgatgagattcaaggtagatatcctcatcttcttgaacagctgttg
tcaacttcagataccactggagaagaaaatgctgacccaccaattattcattttggacct
ggagaaagttcttcagaagatgctgtcatgatgaatacacctgtggttaaatctgccttg
gaaatgggctttaatagagacctggtgaaacaaacagttcaaagtaaaatcctgacaact
ggagagaactataaaacagttaatgatattgtgtcagcacttcttaatgctgaagatgaa
aaaagagaagaggagaaggaaaaacaagctgaagaaatggcatcagatgatttgtcatta
attcggaagaacagaatggctctctttcaacaattgacatgtgtgcttcctatcctggat
aatcttttaaaggccaatgtaattaataaacaggaacatgatattattaaacaaaaaaca
cagatacctttacaagcgagagaactgattgataccattttggttaaaggaaatgctgcg
gccaacatcttcaaaaactgtctaaaagaaattgactctacattgtataagaacttattt
gtggataagaatatgaagtatattccaacagaagatgtttcaggtctgtcactggaagaa
caattgaggaggttgcaagaagaacgaacttgtaaagtgtgtatggacaaagaagtttct
gttgtatttattccttgtggtcatctggtagtatgccaggaatgtgccccttctctaaga
aaatgccctatttgcaggggtataatcaagggtactgttcgtacatttctctcttaa

Protein Sequence

>329 : length: 618
MHKTASQRLFPGPSYQNIKSIMEDSTILSDWTNSNKQKMKYDFSCELYRMSTYSTFPAGV
PVSERSLARAGFYYTGVNDKVKCFCCGLMLDNWKLGDSPIQKHKQLYPSCSFIQNLVSAS
LGSTSKNTSPMRNSFAHSLSPTLEHSSLFSGSYSSLSPNPLNSRAVEDISSSRTNPYSYA
MSTEEARFLTYHMWPLTFLSPSELARAGFYYIGPGDRVACFACGGKLSNWEPKDDAMSEH
RRHFPNCPFLENSLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGR
NDDVKCFCCDGGLRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLL
STSDTTGEENADPPIIHFGPGESSSEDAVMMNTPVVKSALEMGFNRDLVKQTVQSKILTT
GENYKTVNDIVSALLNAEDEKREEEKEKQAEEMASDDLSLIRKNRMALFQQLTCVLPILD
NLLKANVINKQEHDIIKQKTQIPLQARELIDTILVKGNAAANIFKNCLKEIDSTLYKNLF
VDKNMKYIPTEDVSGLSLEEQLRRLQEERTCKVCMDKEVSVVFIPCGHLVVCQECAPSLR
KCPICRGIIKGTVRTFLS



')