Epithelial-Mesenchymal Transition gene database (dbEMT) Home
dbEMT
Pediatric cancer database
General information | Literature | Expression | Regulation | Variant | Interaction

Basic Information

Gene ID

3248

Name

HPGD

Synonym

15-PGDH|PGDH|PGDH1|SDR36C1;hydroxyprostaglandin dehydrogenase 15-(NAD);HPGD;hydroxyprostaglandin dehydrogenase 15-(NAD)

Definition

15-hydroxyprostaglandin dehydrogenase [NAD+]|NAD+-dependent 15-hydroxyprostaglandin dehydrogenase|prostaglandin dehydrogenase 1|short chain dehydrogenase/reductase family 36C, member 1

Position

4q34-q35

Gene Type

protein-coding

External Links

Links to Entrez Gene

3248

Links to all GeneRIF Items

3248

Links to iHOP

3248

Sequence Information

Nucleotide Sequence

>3248 : length: 801
atgcacgtgaacggcaaagtggcgctggtgaccggcgcggctcagggcataggcagagcc
tttgcagaggcgctgctgcttaagggcgccaaggtagcgctggtggattggaatcttgaa
gcaggtgtacagtgtaaagctgccctggatgagcagtttgaacctcagaagactctgttc
atccagtgcgatgtggctgaccagcaacaactgagagacacttttagaaaagttgtagac
cactttggaagactggacattttggtcaataatgctggagtgaataatgagaaaaactgg
gaaaaaactctgcaaattaatttggtttctgttatcagtggaacctatcttggtttggat
tacatgagtaagcaaaatggaggtgaaggcggcatcattatcaatatgtcatctttagca
ggactcatgcccgttgcacagcagccggtttattgtgcttcaaagcatggcatagttgga
ttcacacgctcagcagcgttggctgctaatcttatgaacagtggtgtgagactgaatgcc
atttgtccaggctttgttaacacagccatccttgaatcaattgaaaaagaagaaaacatg
ggacaatatatagaatataaggatcatatcaaggatatgattaaatactatggaattttg
gacccaccattgattgccaatggattgataacactcattgaagatgatgctttaaatggt
gctattatgaagatcacaacttctaagggaattcattttcaagactatgatacaactcca
tttcaagcaaaaacccaatga

Protein Sequence

>3248 : length: 266
MHVNGKVALVTGAAQGIGRAFAEALLLKGAKVALVDWNLEAGVQCKAALDEQFEPQKTLF
IQCDVADQQQLRDTFRKVVDHFGRLDILVNNAGVNNEKNWEKTLQINLVSVISGTYLGLD
YMSKQNGGEGGIIINMSSLAGLMPVAQQPVYCASKHGIVGFTRSAALAANLMNSGVRLNA
ICPGFVNTAILESIEKEENMGQYIEYKDHIKDMIKYYGILDPPLIANGLITLIEDDALNG
AIMKITTSKGIHFQDYDTTPFQAKTQ



')